(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE486

PENCW_10.PE486       Location/Qualifiers
FT   CDS             join(complement(1181429..1181453),
FT                   complement(1179735..1181182),complement(1179353..1179643))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825426"
FT                   /orf_name="Pc13g04860"
FT                   /product="Pc13g04860 protein"
FT                   /protein_id="CAP91555.1"
FT                   /db_xref="UniParc:UPI0001830EB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C0"
FT                   /transl_table=1
FT                   /translation="MFGWGSGLALPSATSEPEKERRPPADPTPLDFPVYNLSSVLENES
FT                   ESRLKEMAELLAEIKRPQDICAERFKPLNLKLETGVEVAQMIPEDNSHPVAPLPWEDTT
FT                   EPTEDNPRPLMDNGLPYPSKERYEVLEKELALDNDDAFREVARLPPREGRSRVRITQSR
FT                   KFWTGLERMAQYWDTSLDHYYERPATPDPTPPSEMDRTEDGTMQTDAGDSAAGHSLTDD
FT                   AMDVDNAQTDAPSSNGIVGEEQRPSVPLYTGRRIGNGAEMPDELRDETIRAFVEMAAWP
FT                   FGCQVTVPTLQPRLTTKNLLFPVRQTFQSSRSPRDRQIARSGMLEGPVLISQCRPETSF
FT                   RTADNAPGTGIGDVSDLFREVGGMLLAAQERAREGAVEKRPGEGKWWTMQPRFGGAPND
FT                   GILDDLVNHGHGMSLPDSMMEESTPSAQEAENASKRHKFEHPFVTSLSRRPSAMRRLTT
FT                   SEKWKILQPGPSLWDKRMSYLQIGKVQESPFDDIYMISSINHHVSILHLRVHRRYLDIL
FT                   TYGDSTFPATEGEPWHVLKLQRTRWFDLLDTNDRIEALKGVWQLFHHQLRQTRHEGDVP
FT                   VPIELPLERPL"
     MFGWGSGLAL PSATSEPEKE RRPPADPTPL DFPVYNLSSV LENESESRLK EMAELLAEIK        60
     RPQDICAERF KPLNLKLETG VEVAQMIPED NSHPVAPLPW EDTTEPTEDN PRPLMDNGLP       120
     YPSKERYEVL EKELALDNDD AFREVARLPP REGRSRVRIT QSRKFWTGLE RMAQYWDTSL       180
     DHYYERPATP DPTPPSEMDR TEDGTMQTDA GDSAAGHSLT DDAMDVDNAQ TDAPSSNGIV       240
     GEEQRPSVPL YTGRRIGNGA EMPDELRDET IRAFVEMAAW PFGCQVTVPT LQPRLTTKNL       300
     LFPVRQTFQS SRSPRDRQIA RSGMLEGPVL ISQCRPETSF RTADNAPGTG IGDVSDLFRE       360
     VGGMLLAAQE RAREGAVEKR PGEGKWWTMQ PRFGGAPNDG ILDDLVNHGH GMSLPDSMME       420
     ESTPSAQEAE NASKRHKFEH PFVTSLSRRP SAMRRLTTSE KWKILQPGPS LWDKRMSYLQ       480
     IGKVQESPFD DIYMISSINH HVSILHLRVH RRYLDILTYG DSTFPATEGE PWHVLKLQRT       540
     RWFDLLDTND RIEALKGVWQ LFHHQLRQTR HEGDVPVPIE LPLERPL                     587
//

If you have problems or comments...

PBIL Back to PBIL home page