(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE487

PENCW_10.PE487       Location/Qualifiers
FT   CDS             1182936..1184210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672739"
FT                   /orf_name="Pc13g04870"
FT                   /product="Putative uncharacterized protein Pc13g04870 "
FT                   /protein_id="CAP91556.1"
FT                   /db_xref="UniParc:UPI0001830EB1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C1"
FT                   /transl_table=1
FT                   /translation="MPSTFSAIDTPSTPLNFIGTWSTGSSNLVTVTSIETETIYPTWIY
FT                   TISGSGPDSSTTTTVLNLSSSTLNPTQVTVTQTTKLSTTEQETIISSSSSTSTVISESP
FT                   MSPVILTTSVLSGQMGDLPFSATAKSSDHSWYSDAPSSIWTLPIPLIPSTSASVPLSSS
FT                   LPVLPETATSSVSHMSSISTPASSIIAATETPTISPSIGTVTSESSSEPSQADNPSPTS
FT                   SKIGMIVGSIIGGSAVTIFALLACALYMRRRRRKNAAERQGIRQKLIRGDSTSSSISHH
FT                   RHHSYPSIPGNISLRSPILPFIPLQQQPSNPDLSLDSMYLRGETRAQDPFADPPSTVIE
FT                   ISAPTRSASLYSTSSLGAGVGARGYWDCEREGANALAVPNEYSDTPVMRDSMRSDPFDL
FT                   DLEPPPSAHHRSSVPSISSTWGVKF"
     MPSTFSAIDT PSTPLNFIGT WSTGSSNLVT VTSIETETIY PTWIYTISGS GPDSSTTTTV        60
     LNLSSSTLNP TQVTVTQTTK LSTTEQETII SSSSSTSTVI SESPMSPVIL TTSVLSGQMG       120
     DLPFSATAKS SDHSWYSDAP SSIWTLPIPL IPSTSASVPL SSSLPVLPET ATSSVSHMSS       180
     ISTPASSIIA ATETPTISPS IGTVTSESSS EPSQADNPSP TSSKIGMIVG SIIGGSAVTI       240
     FALLACALYM RRRRRKNAAE RQGIRQKLIR GDSTSSSISH HRHHSYPSIP GNISLRSPIL       300
     PFIPLQQQPS NPDLSLDSMY LRGETRAQDP FADPPSTVIE ISAPTRSASL YSTSSLGAGV       360
     GARGYWDCER EGANALAVPN EYSDTPVMRD SMRSDPFDLD LEPPPSAHHR SSVPSISSTW       420
     GVKF                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page