(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE488

PENCW_10.PE488       Location/Qualifiers
FT   CDS             join(complement(1185988..>1186285),
FT                   complement(1185728..1185878),complement(1185451..1185594))
FT                   /codon_start=3
FT                   /gene_family="HOG000231277" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15951952"
FT                   /orf_name="Pc13g04880"
FT                   /product="Pc13g04880 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91557.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="UniParc:UPI0001830EB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2C2"
FT                   /transl_table=1
FT                   /translation="ADRVFHHHRVNLTTQKRLAASVVGCGKRKIWLDPNEMSEISNANS
FT                   RQTIRKLVSDGLIIRKPVTMHSRASARELNEARRNGRHRGLGKRKGTKDARMPSQVLWM
FT                   RRMRVLRRLLVRYRAAGKIDKHLYHELYHLSKGNTFKHKRALVEHIQKAKAERARDRVL
FT                   KEEMDAKRAKNKALRERRLERKEAKRDALINEE"
     ADRVFHHHRV NLTTQKRLAA SVVGCGKRKI WLDPNEMSEI SNANSRQTIR KLVSDGLIIR        60
     KPVTMHSRAS ARELNEARRN GRHRGLGKRK GTKDARMPSQ VLWMRRMRVL RRLLVRYRAA       120
     GKIDKHLYHE LYHLSKGNTF KHKRALVEHI QKAKAERARD RVLKEEMDAK RAKNKALRER       180
     RLERKEAKRD ALINEE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page