(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE489

PENCW_10.PE489       Location/Qualifiers
FT   CDS             join(complement(1195071..1195146),
FT                   complement(1192295..1195057),complement(1188403..1192227),
FT                   complement(1188158..1188349),complement(1187942..1188097),
FT                   complement(1187806..1187887),complement(1187607..1187748),
FT                   complement(1186997..1187551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825427"
FT                   /orf_name="Pc13g04890"
FT                   /product="Pc13g04890 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91558.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022716"
FT                   /db_xref="UniParc:UPI0001830EB3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G6"
FT                   /transl_table=1
FT                   /translation="MPPLSPPRPQCDRRNKIPHAKIANRGLASSFAFVLLEWCCILLQQ
FT                   ASEDQNTPLPTVLDLIAVDAKALENCLSHNPKPAVKQSALRVTRRALRAVFTSEAWGAD
FT                   AVRQSVSRLTADAAAANKNAPLLGVVCGVCARLADKTPILEELKKDILAFYIKEVVSSK
FT                   SAVPAHVANGMPDFFTSFVTYEDVATELVPPMEKSILRAPEVVLGGVIPPLCASLPEEI
FT                   DLSELVQTRLSKNLLTSMKSNNPSIRQGASDSFASLLSRCRTDSLVLKITSEIVGPLKT
FT                   QKITTPEHRLAYAQAIGAISPSADVSKEIVQGFCPVFSRESNEAALEEEIKSFSKHLTY
FT                   LVQSKLKVSDDVISTIVKGVSDKRIPFRKIWQANVGEVLWTSDLEDLKAPETEPLLTKF
FT                   LAKMKDLFGEVASNPLPSAQSGALSSAYLFLALFHRVSDVQGSARSAWEEHVTQSMTLS
FT                   PKPSFLLNPRAYSKLSSKAEVQWLVRALAAVASGPNFSSSDDASKTAWAQTFIYAITAP
FT                   AIPSNIRENSAETLSRVYQTDVASFGRIVLNALWAWILSFRTADKESAAVSAGPESERL
FT                   LHMVLKALCPTKAVIETSGISSSDLEVLLIEMLILGRPELIPNTSWIELCLRTGTDPGD
FT                   LVRAHAANCIEQLVCVNTDPVQSAVPNVNLAVFSAGAELAFVAPDAMIPRLVDQIKYDL
FT                   DGTRLSKFTATDAAISRTPEGTAFVDVLSSKSKQPAFDKNTKDYDTLKWEEELRAQLAE
FT                   KKGQSQKKLTPEENSKVKAQLAKEAKIRQDVLEEVKRIERGAGLIRALATGPANDVEGW
FT                   INAAVSSLLSLAQAGAGLFVGDVVSRAFITCADEVSTRLGPLRPFVGIATLRAIGNTNL
FT                   PSDMELEPLGELVTRILYRLRFASEQRPFDATSLAYVLPLVSLILTKNGIEEGKGEEEG
FT                   TQVLLALEFLSFHSSSFTDTRLPRVEVLSQLLSAMQKYTQHYKLVKDTLFDFCRCISPS
FT                   INSEELDTLLQGTVVAEASVRTTVLQVIEAEIDLTDLDFSEHIWLGCHDIVEENAEIAD
FT                   TIWEDNALEVDDTSFSKIMKYLDSKDYQLRGAAARALAHAIEFDKSKFAGILSELQSKY
FT                   VEEIKPKAPEKDAYGMPKKVDNADHWEARSGIALAFNAMTNGFDGDESVSFLRFLIEKG
FT                   PLLDGNSRVRGQMTESGKSVIILRGESKVEEMMNLLQTTLETSDKDTKTSDLLNEAVIV
FT                   LYGSVATHLKADDPRLQTVISELLVALDTPSESVQHAVSECLPPLIRSSGSKTAEYVEN
FT                   LLHRLFNAPDYPRQRGAAYGLAAVVCGRGVATLREYRIMSQLKEAAENKKEKDHRRGAL
FT                   LAYELFALVLGRTFEPYVIHLVPQLLAGFGDTSISVRETCLEASRACFQNLSSYGVKEI
FT                   LPTLLDGLDDTQWRSQKGACDLLGAMAYLDPQQLAASLPDIIPPLTVVLNDTHKEVRSA
FT                   ANRSLQRFGEVISNPEVKSLVGVLLKALSDPTKHTDEALDSLIKVSFAHYLDAPSLALV
FT                   VRILERGLGDRSNTKRKSAQIIGSLAHLTERKDLISHLPIIVAGLNLAIVDPVPTTRAT
FT                   ASKALGSLIEKLGEDALPDLIPNLMATLKSDTGAGDRLGSAQALSEVLAGLGTTRLEET
FT                   LPTILHNVSSAKPSVREGFMTLFIFLPACFGNSFANYLSKIIPPILAGLADDIEAIRET
FT                   ALRAGRLLVKNFAHKAIDLLLPELERGLADDSYRIRLSSVELVGDLLFSLTGISGKQEG
FT                   DEEEEEATQAGQSLLEVLGAERRDKVLSALYICRCDTSGQVKSAALGVWKALVASPRTL
FT                   KDMVPTLSQLIIRRLGSSNMEQKVIASNALGDLIKKAGESVLSTLLPLLQDGLQASPDV
FT                   EVKQGICIALRELINAASPDALEDYEDILISTVRVALVDNDDDVREAAAEAFDSLQQIM
FT                   GKRVVDQVLPYLLHLLRNDEDAEQALSALLTLLTEQTRANIILPNLIPTLLTPPITAFN
FT                   ARALASLAEVAGSAMTRRLPTILNSLMDGIIETTDEELRTELSTAFDTVLVSVDEYDGL
FT                   SAAMNVMITLVKHDDHHRRAAAALHLTKFFAEAELDFSRYYQDLIRALLISFDDPDKDV
FT                   VKSAWTALAGLMSHMRKEEMESLAIPTRQILRQVGVAGADLPGFSLPKGIMAILPIFLQ
FT                   GLLNGTTDQRTQSALAMSDIIDRTRAESLKPFVTQITGPLIRVVSERSVDIKCAIFYTL
FT                   NKLLEKIPLAVKPFLPQLQRTFARGLADTTSETLRNRAAKGLGILITLTPRVDPLIAEL
FT                   IAGSKTTDIGVKNAMMKALQEVVGKAGANMSEASRQAILGLIDDDASDQTDSVAITNAR
FT                   LLGALVKVLPAASSVPLIKNRILTGSLSHAAVLGLNALLAECPEVLTEHFSVELPTVIC
FT                   QGLANQDPFISDNSALAAGKYLLSNDADHAFESSKVIFEALASAIQVGKPVDTRRLSLV
FT                   VIRTVSRLHPELARPHLALLAPPIFAGVRDLVIPVKLAAEAAFLSIFSVVESDSEVFDK
FT                   YMAGPGASLPPGPKRSMSDYFKRIAVRLANQARERREAEGGEGGLGLSNDEIDDEKELW
FT                   SIGKVDLGEAFGDE"
     MPPLSPPRPQ CDRRNKIPHA KIANRGLASS FAFVLLEWCC ILLQQASEDQ NTPLPTVLDL        60
     IAVDAKALEN CLSHNPKPAV KQSALRVTRR ALRAVFTSEA WGADAVRQSV SRLTADAAAA       120
     NKNAPLLGVV CGVCARLADK TPILEELKKD ILAFYIKEVV SSKSAVPAHV ANGMPDFFTS       180
     FVTYEDVATE LVPPMEKSIL RAPEVVLGGV IPPLCASLPE EIDLSELVQT RLSKNLLTSM       240
     KSNNPSIRQG ASDSFASLLS RCRTDSLVLK ITSEIVGPLK TQKITTPEHR LAYAQAIGAI       300
     SPSADVSKEI VQGFCPVFSR ESNEAALEEE IKSFSKHLTY LVQSKLKVSD DVISTIVKGV       360
     SDKRIPFRKI WQANVGEVLW TSDLEDLKAP ETEPLLTKFL AKMKDLFGEV ASNPLPSAQS       420
     GALSSAYLFL ALFHRVSDVQ GSARSAWEEH VTQSMTLSPK PSFLLNPRAY SKLSSKAEVQ       480
     WLVRALAAVA SGPNFSSSDD ASKTAWAQTF IYAITAPAIP SNIRENSAET LSRVYQTDVA       540
     SFGRIVLNAL WAWILSFRTA DKESAAVSAG PESERLLHMV LKALCPTKAV IETSGISSSD       600
     LEVLLIEMLI LGRPELIPNT SWIELCLRTG TDPGDLVRAH AANCIEQLVC VNTDPVQSAV       660
     PNVNLAVFSA GAELAFVAPD AMIPRLVDQI KYDLDGTRLS KFTATDAAIS RTPEGTAFVD       720
     VLSSKSKQPA FDKNTKDYDT LKWEEELRAQ LAEKKGQSQK KLTPEENSKV KAQLAKEAKI       780
     RQDVLEEVKR IERGAGLIRA LATGPANDVE GWINAAVSSL LSLAQAGAGL FVGDVVSRAF       840
     ITCADEVSTR LGPLRPFVGI ATLRAIGNTN LPSDMELEPL GELVTRILYR LRFASEQRPF       900
     DATSLAYVLP LVSLILTKNG IEEGKGEEEG TQVLLALEFL SFHSSSFTDT RLPRVEVLSQ       960
     LLSAMQKYTQ HYKLVKDTLF DFCRCISPSI NSEELDTLLQ GTVVAEASVR TTVLQVIEAE      1020
     IDLTDLDFSE HIWLGCHDIV EENAEIADTI WEDNALEVDD TSFSKIMKYL DSKDYQLRGA      1080
     AARALAHAIE FDKSKFAGIL SELQSKYVEE IKPKAPEKDA YGMPKKVDNA DHWEARSGIA      1140
     LAFNAMTNGF DGDESVSFLR FLIEKGPLLD GNSRVRGQMT ESGKSVIILR GESKVEEMMN      1200
     LLQTTLETSD KDTKTSDLLN EAVIVLYGSV ATHLKADDPR LQTVISELLV ALDTPSESVQ      1260
     HAVSECLPPL IRSSGSKTAE YVENLLHRLF NAPDYPRQRG AAYGLAAVVC GRGVATLREY      1320
     RIMSQLKEAA ENKKEKDHRR GALLAYELFA LVLGRTFEPY VIHLVPQLLA GFGDTSISVR      1380
     ETCLEASRAC FQNLSSYGVK EILPTLLDGL DDTQWRSQKG ACDLLGAMAY LDPQQLAASL      1440
     PDIIPPLTVV LNDTHKEVRS AANRSLQRFG EVISNPEVKS LVGVLLKALS DPTKHTDEAL      1500
     DSLIKVSFAH YLDAPSLALV VRILERGLGD RSNTKRKSAQ IIGSLAHLTE RKDLISHLPI      1560
     IVAGLNLAIV DPVPTTRATA SKALGSLIEK LGEDALPDLI PNLMATLKSD TGAGDRLGSA      1620
     QALSEVLAGL GTTRLEETLP TILHNVSSAK PSVREGFMTL FIFLPACFGN SFANYLSKII      1680
     PPILAGLADD IEAIRETALR AGRLLVKNFA HKAIDLLLPE LERGLADDSY RIRLSSVELV      1740
     GDLLFSLTGI SGKQEGDEEE EEATQAGQSL LEVLGAERRD KVLSALYICR CDTSGQVKSA      1800
     ALGVWKALVA SPRTLKDMVP TLSQLIIRRL GSSNMEQKVI ASNALGDLIK KAGESVLSTL      1860
     LPLLQDGLQA SPDVEVKQGI CIALRELINA ASPDALEDYE DILISTVRVA LVDNDDDVRE      1920
     AAAEAFDSLQ QIMGKRVVDQ VLPYLLHLLR NDEDAEQALS ALLTLLTEQT RANIILPNLI      1980
     PTLLTPPITA FNARALASLA EVAGSAMTRR LPTILNSLMD GIIETTDEEL RTELSTAFDT      2040
     VLVSVDEYDG LSAAMNVMIT LVKHDDHHRR AAAALHLTKF FAEAELDFSR YYQDLIRALL      2100
     ISFDDPDKDV VKSAWTALAG LMSHMRKEEM ESLAIPTRQI LRQVGVAGAD LPGFSLPKGI      2160
     MAILPIFLQG LLNGTTDQRT QSALAMSDII DRTRAESLKP FVTQITGPLI RVVSERSVDI      2220
     KCAIFYTLNK LLEKIPLAVK PFLPQLQRTF ARGLADTTSE TLRNRAAKGL GILITLTPRV      2280
     DPLIAELIAG SKTTDIGVKN AMMKALQEVV GKAGANMSEA SRQAILGLID DDASDQTDSV      2340
     AITNARLLGA LVKVLPAASS VPLIKNRILT GSLSHAAVLG LNALLAECPE VLTEHFSVEL      2400
     PTVICQGLAN QDPFISDNSA LAAGKYLLSN DADHAFESSK VIFEALASAI QVGKPVDTRR      2460
     LSLVVIRTVS RLHPELARPH LALLAPPIFA GVRDLVIPVK LAAEAAFLSI FSVVESDSEV      2520
     FDKYMAGPGA SLPPGPKRSM SDYFKRIAVR LANQARERRE AEGGEGGLGL SNDEIDDEKE      2580
     LWSIGKVDLG EAFGDE                                                      2596
//

If you have problems or comments...

PBIL Back to PBIL home page