(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE49

PENCW_10.PE49        Location/Qualifiers
FT   CDS             join(114755..114975,115059..115185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948700"
FT                   /orf_name="Pc13g00490"
FT                   /product="Putative uncharacterized protein Pc13g00490 "
FT                   /protein_id="CAP91118.1"
FT                   /db_xref="UniParc:UPI0001830E97"
FT                   /db_xref="UniProtKB/TrEMBL:B6H187"
FT                   /transl_table=1
FT                   /translation="MGGDNLDALCFAGQTVELPEALGLLEPEYVFLETGRVLPGNDTGI
FT                   PGSPCSPRSPYLSPKEPDFRSQEPSSLQPGPRVPRNLYCFPRRREKRHVQHRSFDCRVI
FT                   NQGPLGLFSFI"
     MGGDNLDALC FAGQTVELPE ALGLLEPEYV FLETGRVLPG NDTGIPGSPC SPRSPYLSPK        60
     EPDFRSQEPS SLQPGPRVPR NLYCFPRRRE KRHVQHRSFD CRVINQGPLG LFSFI            115
//

If you have problems or comments...

PBIL Back to PBIL home page