(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE490

PENCW_10.PE490       Location/Qualifiers
FT   CDS             join(1195722..1196484,1196542..1198087,1198158..1199455,
FT                   1199505..1199718,1199780..1200107,1200174..1200383)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825428"
FT                   /orf_name="Pc13g04900"
FT                   /product="Pc13g04900 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91559.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001830EB4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2G7"
FT                   /transl_table=1
FT                   /translation="MPPSSKKKKKPASNPARGFATVSMPSKPKPEAATTPSSAAEESKP
FT                   TPENEPQPERTDVRTADAAAPPTTSSLQDYTPEELEKHLEEAELQILVDKYAFKCKNDA
FT                   TRQATKLDNERRVFRQQSVTLSLLEWLPTDIQDSILELGSTEEHDYLITSGRVPSSKQA
FT                   GSDEDLYNKLWTLKETLLKLDFPANRVEDALKHVLQYFAGNSANAGRDVVWNLDEAIEW
FT                   LATHSDKNELPSYTQTNTRQLKDTDSVTSWMTESKGSGTSTPISSQNRSKQENKKVDWK
FT                   AEKAATPLSYDSDSSVDPDIMVPEWLELQTQLYSLDPDLFDRPGKGKKGRGGAGNLSDD
FT                   PETSKVQRKIAKIERDVLFERREAEYIWEQKLDELRKDASFIRRPVDKKKKSPTDAEDQ
FT                   PKPEINEEIDPALLAIDGMEDALGDLFQGEAEDPGSILGIAPPESQTPVILRDFGKSTG
FT                   LSPRRVLEETCKSRDSSCVVVYQDFSSSGHSNRKALEVRWSKPQEVPFPLAVESITHKS
FT                   NALATFVSMDALATPTAQQAEGYVSTLALFILFPQNSKEGKAYLRLPAVWRDLWTEFAT
FT                   LQKTQQDEVDKSTLKELKLLIQENQGTFEDDVVLSDNFRKRNGVGSKPGTPVEGSTRDS
FT                   YPGIDDRLKEAWMAKSSTPSYQRMIQGRMNLPIWGFKDEILSTLDDHRALIICSETGSG
FT                   KSTQIPSFVLEHEMVHGRPCKIYVTEPRRISAISLARRVSEELGESKNDVGTNRSLIGF
FT                   AVRLESKFTQSTPLIYATTGVVVRMLERPEDFQDITHVVLDEVHERTIDSDFLLIVLRR
FT                   LMQKRPDLKLILMSATLDAQRFSNYLGGVPVLNIPGRTFPVEMKYLEDAVEMTNYRLSE
FT                   DVQHTVLDDDMDDPPTDADTTGGLQSSLDGYSRQTKETVINIDEYRLDYELIKRLLLKL
FT                   ATAPEMAHYSKAILIFMPGLAEIRRLNDEILSEPMFQRGWIVHTLHSSIASEDQEKAFN
FT                   VPPEGTRKIVIATNIAETGITIPDITAVVDAGKEKIMRFDERRQLSRLVESFISRANAK
FT                   QRRGRAGRVQNGICFHLFTKHRHEKLLSEQQTPELLRLSLQDLVLRVKICKLGEVEQTL
FT                   LEALDPPSSKNIRRAIDSLKEVKALTSNESLTSLGTQLAKLPLDVFLGKMIIHGAFFRC
FT                   LDATVSIAAILSSKSPFVNTIGSNSQRDGARASFRRGDSDLLTVYNAYCSWRRIRSTPG
FT                   SNEYSFCRKNFLSPQTLLAIEDIKMQLVVSIADAGLLTLDASQKAALNRARSNSRNRQF
FT                   FVIPEDFDINSNNDIVVNSVIAWSFYPKLLTREGKGWRNVGNNQTVTLPAVSVNKRADS
FT                   SVKWLSYYSIMARARNLSAHDTSAVDDFAIALLCGDAEFKMYAGVVSIDANRIRFAVRD
FT                   WKSMLALKILNSRLREILSNTFRNPHRPLSYKHQQWIDIWQQIFAQAGKR"
     MPPSSKKKKK PASNPARGFA TVSMPSKPKP EAATTPSSAA EESKPTPENE PQPERTDVRT        60
     ADAAAPPTTS SLQDYTPEEL EKHLEEAELQ ILVDKYAFKC KNDATRQATK LDNERRVFRQ       120
     QSVTLSLLEW LPTDIQDSIL ELGSTEEHDY LITSGRVPSS KQAGSDEDLY NKLWTLKETL       180
     LKLDFPANRV EDALKHVLQY FAGNSANAGR DVVWNLDEAI EWLATHSDKN ELPSYTQTNT       240
     RQLKDTDSVT SWMTESKGSG TSTPISSQNR SKQENKKVDW KAEKAATPLS YDSDSSVDPD       300
     IMVPEWLELQ TQLYSLDPDL FDRPGKGKKG RGGAGNLSDD PETSKVQRKI AKIERDVLFE       360
     RREAEYIWEQ KLDELRKDAS FIRRPVDKKK KSPTDAEDQP KPEINEEIDP ALLAIDGMED       420
     ALGDLFQGEA EDPGSILGIA PPESQTPVIL RDFGKSTGLS PRRVLEETCK SRDSSCVVVY       480
     QDFSSSGHSN RKALEVRWSK PQEVPFPLAV ESITHKSNAL ATFVSMDALA TPTAQQAEGY       540
     VSTLALFILF PQNSKEGKAY LRLPAVWRDL WTEFATLQKT QQDEVDKSTL KELKLLIQEN       600
     QGTFEDDVVL SDNFRKRNGV GSKPGTPVEG STRDSYPGID DRLKEAWMAK SSTPSYQRMI       660
     QGRMNLPIWG FKDEILSTLD DHRALIICSE TGSGKSTQIP SFVLEHEMVH GRPCKIYVTE       720
     PRRISAISLA RRVSEELGES KNDVGTNRSL IGFAVRLESK FTQSTPLIYA TTGVVVRMLE       780
     RPEDFQDITH VVLDEVHERT IDSDFLLIVL RRLMQKRPDL KLILMSATLD AQRFSNYLGG       840
     VPVLNIPGRT FPVEMKYLED AVEMTNYRLS EDVQHTVLDD DMDDPPTDAD TTGGLQSSLD       900
     GYSRQTKETV INIDEYRLDY ELIKRLLLKL ATAPEMAHYS KAILIFMPGL AEIRRLNDEI       960
     LSEPMFQRGW IVHTLHSSIA SEDQEKAFNV PPEGTRKIVI ATNIAETGIT IPDITAVVDA      1020
     GKEKIMRFDE RRQLSRLVES FISRANAKQR RGRAGRVQNG ICFHLFTKHR HEKLLSEQQT      1080
     PELLRLSLQD LVLRVKICKL GEVEQTLLEA LDPPSSKNIR RAIDSLKEVK ALTSNESLTS      1140
     LGTQLAKLPL DVFLGKMIIH GAFFRCLDAT VSIAAILSSK SPFVNTIGSN SQRDGARASF      1200
     RRGDSDLLTV YNAYCSWRRI RSTPGSNEYS FCRKNFLSPQ TLLAIEDIKM QLVVSIADAG      1260
     LLTLDASQKA ALNRARSNSR NRQFFVIPED FDINSNNDIV VNSVIAWSFY PKLLTREGKG      1320
     WRNVGNNQTV TLPAVSVNKR ADSSVKWLSY YSIMARARNL SAHDTSAVDD FAIALLCGDA      1380
     EFKMYAGVVS IDANRIRFAV RDWKSMLALK ILNSRLREIL SNTFRNPHRP LSYKHQQWID      1440
     IWQQIFAQAG KR                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page