(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE493

PENCW_10.PE493       Location/Qualifiers
FT   CDS             join(complement(1213930..1214166),
FT                   complement(1213004..1213870))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825430"
FT                   /orf_name="Pc13g04930"
FT                   /product="Pc13g04930 protein"
FT                   /protein_id="CAP91562.1"
FT                   /db_xref="UniParc:UPI0001830F7F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2H0"
FT                   /transl_table=1
FT                   /translation="MHMRTLLLLIWAIAAPALGWRGEMPAQRSYMYVGGQYILNSAGQH
FT                   VFADQMYVEKLTPAAGITKPYPIVFIHGQAQTGTNWLNKPDGGEGWASYFLSQGYACYI
FT                   IDQTFRGRSAWFPGNGTMNTYSAELLQQRFTAPKLYNLWPQASLHTQWNGTGVMGDPNF
FT                   DNYYSSTVEFLSSATHQQSTVQAAGATLLDTIGSPVILIAHSQGGTIPWLLADVRPNLV
FT                   HSIVSIEPTGPPFQDAVFSNSSTRAYGLTDIPLTYSPALADPVELVKHVIPSNSSLYSD
FT                   CVIQADSPAPRQLVNLAGVPILVLTTESSYHAPYDWCTVKFLQQAGVPAEHLQLADIGI
FT                   HGNGHMVFMEKNSLQVAAVLQKWMERT"
     MHMRTLLLLI WAIAAPALGW RGEMPAQRSY MYVGGQYILN SAGQHVFADQ MYVEKLTPAA        60
     GITKPYPIVF IHGQAQTGTN WLNKPDGGEG WASYFLSQGY ACYIIDQTFR GRSAWFPGNG       120
     TMNTYSAELL QQRFTAPKLY NLWPQASLHT QWNGTGVMGD PNFDNYYSST VEFLSSATHQ       180
     QSTVQAAGAT LLDTIGSPVI LIAHSQGGTI PWLLADVRPN LVHSIVSIEP TGPPFQDAVF       240
     SNSSTRAYGL TDIPLTYSPA LADPVELVKH VIPSNSSLYS DCVIQADSPA PRQLVNLAGV       300
     PILVLTTESS YHAPYDWCTV KFLQQAGVPA EHLQLADIGI HGNGHMVFME KNSLQVAAVL       360
     QKWMERT                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page