(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE494

PENCW_10.PE494       Location/Qualifiers
FT   CDS             join(1214528..1214721,1214835..1215073,1215140..1215171,
FT                   1215199..1215320,1215377..1215776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951954"
FT                   /orf_name="Pc13g04940"
FT                   /product="Pc13g04940 protein"
FT                   /protein_id="CAP91563.1"
FT                   /db_xref="UniParc:UPI0001830F80"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D6"
FT                   /transl_table=1
FT                   /translation="MDSTLIILWVFTWVAIGLIVLRLLLRKLKGRQFILGDYFAMGAIL
FT                   CALVRLALVHVILIWGTNNMLNGIAGSSRYFFSHVSFSLWLQKLVLLDTYRRLLTNLRW
FT                   EKATMISYIGIFAATYIIVQIVTFTECDPFSHYWMVLPDPGICCRAQLQLIVVSMHSSN
FT                   IVVPSGVLNVITDIMLIALPIPILVLVKRSTIEKIQLAALFAVGLFIVAITIARLPQNA
FT                   KNSTAQVNRTTWASIELLAAAIVANAPVLYGLLKGQSERSKNAASGAGSTGPSQGIKKR
FT                   PANEPEFELQRTRHSKRGSALGSRISSRNYLEIDGESSQSLTRSLEN"
     MDSTLIILWV FTWVAIGLIV LRLLLRKLKG RQFILGDYFA MGAILCALVR LALVHVILIW        60
     GTNNMLNGIA GSSRYFFSHV SFSLWLQKLV LLDTYRRLLT NLRWEKATMI SYIGIFAATY       120
     IIVQIVTFTE CDPFSHYWMV LPDPGICCRA QLQLIVVSMH SSNIVVPSGV LNVITDIMLI       180
     ALPIPILVLV KRSTIEKIQL AALFAVGLFI VAITIARLPQ NAKNSTAQVN RTTWASIELL       240
     AAAIVANAPV LYGLLKGQSE RSKNAASGAG STGPSQGIKK RPANEPEFEL QRTRHSKRGS       300
     ALGSRISSRN YLEIDGESSQ SLTRSLEN                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page