(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE495

PENCW_10.PE495       Location/Qualifiers
FT   CDS             join(1216154..1217034,1217099..1217190,1217333..1217397)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129809"
FT                   /orf_name="Pc13g04950"
FT                   /product="Pc13g04950 protein"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91564.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI0001830F81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D7"
FT                   /transl_table=1
FT                   /translation="MNSDRPERERPAKPQLPEPRNHLHFDPWQSASTGHQRADQGGSFL
FT                   GSTSWRDARSAKLTMQYRSGDCLPGRGTGPGPANKTTQKTTLVPGAFDGKCASESPPKA
FT                   PASGEWAMVAGDVAKRNELDVRDIRSFMGVSKRKAVDELGNETKAEMKKPRTVSGGNGS
FT                   LSPALYAKEMDKETEKSEIEDNPQPKSRSGTGLDLKATSRIFAGVTIFINGSTLPQISE
FT                   YKLKHLLASNGAKTSIYMARKTVTHILVGQPNTGSGTGTAVSGAGGGLAASKLQQEITR
FT                   GGWKGVKVVSVDWALESIKAGRRLAESRFPGMHVAAKGQRSVAESWFPVNLLGWDDESS
FT                   NYMHL"
     MNSDRPERER PAKPQLPEPR NHLHFDPWQS ASTGHQRADQ GGSFLGSTSW RDARSAKLTM        60
     QYRSGDCLPG RGTGPGPANK TTQKTTLVPG AFDGKCASES PPKAPASGEW AMVAGDVAKR       120
     NELDVRDIRS FMGVSKRKAV DELGNETKAE MKKPRTVSGG NGSLSPALYA KEMDKETEKS       180
     EIEDNPQPKS RSGTGLDLKA TSRIFAGVTI FINGSTLPQI SEYKLKHLLA SNGAKTSIYM       240
     ARKTVTHILV GQPNTGSGTG TAVSGAGGGL AASKLQQEIT RGGWKGVKVV SVDWALESIK       300
     AGRRLAESRF PGMHVAAKGQ RSVAESWFPV NLLGWDDESS NYMHL                       345
//

If you have problems or comments...

PBIL Back to PBIL home page