(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE496

PENCW_10.PE496       Location/Qualifiers
FT   CDS             join(complement(1219632..1220390),
FT                   complement(1217858..1219579))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213669" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978595"
FT                   /orf_name="Pc13g04960"
FT                   /product="Pc13g04960 protein"
FT                   /protein_id="CAP91565.1"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI0001830F82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D4"
FT                   /transl_table=1
FT                   /translation="MDPNSALSHANNLLARAETSGRPPVYKAVGISLAVASGVFIGISF
FT                   VVKKIGLLKANVKYNEEAGEGYGYLKNFWWWTGMTLMIVGEICNFVAYAFVDAILVTPL
FT                   GALSVVITTILSAIFLKERLSFVGKVGCFCCIIGSVTIAMNAPEQSSVKDIQSMQHFVI
FT                   QPGFLVYAGVIIVGAAFTALWAGPRYGKSSMFVYISICSMVGGLSVVATQGLGSAILAQ
FT                   INGQEQFKHWFLYVLFVFVIGTLLTEIIYLNKALNLFNAALVTPTYYVMFTSATIITSA
FT                   ILFQGFKGTGVQIATVIIGFLQICAGVVLLQLSKSAKDVPDAAIFKGDLDQIREVAEVE
FT                   EPESEPKADSIRGTASIIRRISTARRTMETDEARRFFHDKHEDTLKVPAENEIIEWDGL
FT                   RRRKTVIGEGPTMSRPITPRTPSVKQHPPWGMSRFPAVEDEENHRPNTKQSGHSFMDSI
FT                   RSRATSVLHPSQWKAVNTEDEKSSNANTQPVGMTGLAQQNGNADAEYHGAGMAGGLEVP
FT                   FNANRPRSDTLRSVSWADEKAESLTPEPIANTARRQFSFNNMMGRMKADSESSVKPTPG
FT                   SPRGILRRTHLAADMRKSATEEESLGLVHGDSRRSQPEEELLNEKLDRWSSAESELGEP
FT                   QPMFAGRSHGNSVSSNISTAAFPAYEDNHHHYSESNNPYYLPHNRQTASSPEPISRDEE
FT                   GWKHPSSRGSGSRTRTRTNSSVHAHSRAPPPAQSSFSTHRHPNPLPPLPDITPTTTLDL
FT                   MPTATNVPALRSVSSESDMVTTLSSEIEDPNDPPPVYPSRQQSGWRRHMSDNSSHDGET
FT                   YATRGGRGSSFRRT"
     MDPNSALSHA NNLLARAETS GRPPVYKAVG ISLAVASGVF IGISFVVKKI GLLKANVKYN        60
     EEAGEGYGYL KNFWWWTGMT LMIVGEICNF VAYAFVDAIL VTPLGALSVV ITTILSAIFL       120
     KERLSFVGKV GCFCCIIGSV TIAMNAPEQS SVKDIQSMQH FVIQPGFLVY AGVIIVGAAF       180
     TALWAGPRYG KSSMFVYISI CSMVGGLSVV ATQGLGSAIL AQINGQEQFK HWFLYVLFVF       240
     VIGTLLTEII YLNKALNLFN AALVTPTYYV MFTSATIITS AILFQGFKGT GVQIATVIIG       300
     FLQICAGVVL LQLSKSAKDV PDAAIFKGDL DQIREVAEVE EPESEPKADS IRGTASIIRR       360
     ISTARRTMET DEARRFFHDK HEDTLKVPAE NEIIEWDGLR RRKTVIGEGP TMSRPITPRT       420
     PSVKQHPPWG MSRFPAVEDE ENHRPNTKQS GHSFMDSIRS RATSVLHPSQ WKAVNTEDEK       480
     SSNANTQPVG MTGLAQQNGN ADAEYHGAGM AGGLEVPFNA NRPRSDTLRS VSWADEKAES       540
     LTPEPIANTA RRQFSFNNMM GRMKADSESS VKPTPGSPRG ILRRTHLAAD MRKSATEEES       600
     LGLVHGDSRR SQPEEELLNE KLDRWSSAES ELGEPQPMFA GRSHGNSVSS NISTAAFPAY       660
     EDNHHHYSES NNPYYLPHNR QTASSPEPIS RDEEGWKHPS SRGSGSRTRT RTNSSVHAHS       720
     RAPPPAQSSF STHRHPNPLP PLPDITPTTT LDLMPTATNV PALRSVSSES DMVTTLSSEI       780
     EDPNDPPPVY PSRQQSGWRR HMSDNSSHDG ETYATRGGRG SSFRRT                      826
//

If you have problems or comments...

PBIL Back to PBIL home page