(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE498

PENCW_10.PE498       Location/Qualifiers
FT   CDS             join(complement(1223339..1223405),
FT                   complement(1222703..1223288),complement(1221410..1222643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213658" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951955"
FT                   /orf_name="Pc13g04980"
FT                   /product="Pc13g04980 protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91567.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001830F84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D8"
FT                   /transl_table=1
FT                   /translation="MDPANLRRKDTTKGPPLRILSLDGGGVRGYSMLILLQELMYRTYV
FT                   ECEGKPPRRDQIPKPCDHFDLIAGTGTGGLIALMLGRLRLDLETCKEVYVRMTRKVFET
FT                   DKTIAGIPYRSTLFKASKLEEAIRECVREHTVYETEGNDTGNAPNRDSMASMTSLPYSP
FT                   ASIPQRSISRGSFSTAAASHPMSPTSQRGSVFLNGLRWGNPDALLYDNRENRTKTAVTA
FT                   MYKGTPRKGTAVLLRSYDSRREPPPEFDCTIWQAGRATSATGLAFKPIQIGQHHFIDEG
FT                   HGTFNPAPLVLDEAVVNEWPGREVGVFVSVGTGKRPPGTNNRQHEWWEDFFSDSLGTFA
FT                   EARRRLMTKIEGCEDIHNDMLRDRLAKRNVSKDNYFRLNVEVGVGEFGMNEWHRLADIS
FT                   TNTRQYLARPEVKKMILEAGVRFAKIDRMNRRLASHAAAGGDRDDLSFDLETEELSLSP
FT                   PVQSHVPPPAHFAVELPAELPADFVGSAHHPPPSQAPLPIPTVVTTSPTEDTLPIHPTP
FT                   QDSISVSSPRQSGSDYRRSHELASRPSSQQQSSPTQSGEYFATFNGMAPPVPPKTPIPY
FT                   PAQEDDGGVAMPAPLFSQAPSSTSNTKVRPPYPVDEPPPTVNRQRKPSYHVR"
     MDPANLRRKD TTKGPPLRIL SLDGGGVRGY SMLILLQELM YRTYVECEGK PPRRDQIPKP        60
     CDHFDLIAGT GTGGLIALML GRLRLDLETC KEVYVRMTRK VFETDKTIAG IPYRSTLFKA       120
     SKLEEAIREC VREHTVYETE GNDTGNAPNR DSMASMTSLP YSPASIPQRS ISRGSFSTAA       180
     ASHPMSPTSQ RGSVFLNGLR WGNPDALLYD NRENRTKTAV TAMYKGTPRK GTAVLLRSYD       240
     SRREPPPEFD CTIWQAGRAT SATGLAFKPI QIGQHHFIDE GHGTFNPAPL VLDEAVVNEW       300
     PGREVGVFVS VGTGKRPPGT NNRQHEWWED FFSDSLGTFA EARRRLMTKI EGCEDIHNDM       360
     LRDRLAKRNV SKDNYFRLNV EVGVGEFGMN EWHRLADIST NTRQYLARPE VKKMILEAGV       420
     RFAKIDRMNR RLASHAAAGG DRDDLSFDLE TEELSLSPPV QSHVPPPAHF AVELPAELPA       480
     DFVGSAHHPP PSQAPLPIPT VVTTSPTEDT LPIHPTPQDS ISVSSPRQSG SDYRRSHELA       540
     SRPSSQQQSS PTQSGEYFAT FNGMAPPVPP KTPIPYPAQE DDGGVAMPAP LFSQAPSSTS       600
     NTKVRPPYPV DEPPPTVNRQ RKPSYHVR                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page