(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE499

PENCW_10.PE499       Location/Qualifiers
FT   CDS             join(complement(1225563..1225577),
FT                   complement(1224316..1225507),complement(1224233..1224255))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672740"
FT                   /orf_name="Pc13g04990"
FT                   /product="Pc13g04990 protein"
FT                   /function="catalytic activity"
FT                   /function="molybdenum ion binding"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP91568.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniParc:UPI0001830F85"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2D9"
FT                   /transl_table=1
FT                   /translation="MKVSQLYVYPVKSLRPTTITEGILTTRGFRYDRHFMLLKVIPVED
FT                   GSGTTTLKNMHVPHFPEMALFRTDIEYPETEKDSGKLIITYHPPAESATRPRETNRLEI
FT                   PLQPDPKALNPLKIVMHQSPTTGYNMGAEYNNWFSARFGYPVVLAYLGPHSREVLGTLA
FT                   PAKKDKKTPLRTICESLTSPDRKWERVLPILIVASAINILLHGGTIIRDGITPQTARSL
FT                   SPTIFTASAVVLVLVLYYFYTVHAQHEDRITFADCAPYLVISETSVDNVSARLPDGEEM
FT                   DRTKFRPNIVVSGAGEAFEEDFWGALTVNAGLERGSSRLLLTGNCVRCQSLNVDYETGK
FT                   MGTGESGAVLKKLMKDRRVDSGAKYSPVFGRYAFLEPKGEGISLRVGDEVMVSEKGTKR
FT                   SIFDWPGMTN"
     MKVSQLYVYP VKSLRPTTIT EGILTTRGFR YDRHFMLLKV IPVEDGSGTT TLKNMHVPHF        60
     PEMALFRTDI EYPETEKDSG KLIITYHPPA ESATRPRETN RLEIPLQPDP KALNPLKIVM       120
     HQSPTTGYNM GAEYNNWFSA RFGYPVVLAY LGPHSREVLG TLAPAKKDKK TPLRTICESL       180
     TSPDRKWERV LPILIVASAI NILLHGGTII RDGITPQTAR SLSPTIFTAS AVVLVLVLYY       240
     FYTVHAQHED RITFADCAPY LVISETSVDN VSARLPDGEE MDRTKFRPNI VVSGAGEAFE       300
     EDFWGALTVN AGLERGSSRL LLTGNCVRCQ SLNVDYETGK MGTGESGAVL KKLMKDRRVD       360
     SGAKYSPVFG RYAFLEPKGE GISLRVGDEV MVSEKGTKRS IFDWPGMTN                   409
//

If you have problems or comments...

PBIL Back to PBIL home page