(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE5

PENCW_10.PE5         Location/Qualifiers
FT   CDS             complement(14290..16698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947666"
FT                   /orf_name="Pc13g00050"
FT                   /product="Pc13g00050 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91074.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR015706"
FT                   /db_xref="UniParc:UPI0001830CF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H2"
FT                   /transl_table=1
FT                   /translation="MEEVERQLLATKSWKAPGEDGLPAIVWKMTWPVVKHGVLELFQAS
FT                   VDEGTLPKQWRHAKIIPLKKPNKENYTIAKAWRPISLLATLGKVLESVIAERISHAVET
FT                   YGLLPTSHFGARKQRSAEQALLLLQEQIYAAWRGRRVLSLISFDVRGAYNGVCKERLLQ
FT                   RMKARGIPEVLLRWVEAFCSERTATIQINGQASEAQSLPQAGLPQGSPLSPILFLFFNA
FT                   DLVQRQIDGQGGAIAFVDDFTAWVTGPTAQSNRHGIETIINEALDWERRSGATFEADKT
FT                   AIIHFAPKASKLDSEPFTIKGETVEPRDHVKVLGVIMDTRLKYKEHMARAASKGLEAAM
FT                   ELRRLRGQSPATARQLFTSTVAPVVDYASSVWMHAFKNKNIGPINRVQRVGAQAIVGTF
FT                   LTVATSVAEAEAHIATVQHRLWRRAAKTWTDIHTLPATNPLRRSTAQIKKFRRYHRSPL
FT                   YQVADALKSIDMETLETISPFTLAPWEERVQGDGQNVPETQTETGGIMRIAVSSSARNG
FT                   MVGFGVAIEKQPPRYRKPRLKTFSVTLGARIEQNPYSGELAAMAYALGTLRVTLLTSNK
FT                   AAALTLKDPRQQSGQEHICQAYKLIKRLRKHENRINNCWVPTSEDNQLLGLAKEQARTA
FT                   TQEDSTPQAQVPRVKSTTLNISRSQAVPKNCLPENVGKHSKRVDAALPGKHTRQLYDRL
FT                   SWKEASVLAQLRTGMARLNGYLYRINVAESDQCACGQARETVEHFLFRCQRWTTHRTEM
FT                   LQCTHTHRGNISFFLGGKSPLDDQNWKPNLEAVRATIRFAIATGRLDAA"
     MEEVERQLLA TKSWKAPGED GLPAIVWKMT WPVVKHGVLE LFQASVDEGT LPKQWRHAKI        60
     IPLKKPNKEN YTIAKAWRPI SLLATLGKVL ESVIAERISH AVETYGLLPT SHFGARKQRS       120
     AEQALLLLQE QIYAAWRGRR VLSLISFDVR GAYNGVCKER LLQRMKARGI PEVLLRWVEA       180
     FCSERTATIQ INGQASEAQS LPQAGLPQGS PLSPILFLFF NADLVQRQID GQGGAIAFVD       240
     DFTAWVTGPT AQSNRHGIET IINEALDWER RSGATFEADK TAIIHFAPKA SKLDSEPFTI       300
     KGETVEPRDH VKVLGVIMDT RLKYKEHMAR AASKGLEAAM ELRRLRGQSP ATARQLFTST       360
     VAPVVDYASS VWMHAFKNKN IGPINRVQRV GAQAIVGTFL TVATSVAEAE AHIATVQHRL       420
     WRRAAKTWTD IHTLPATNPL RRSTAQIKKF RRYHRSPLYQ VADALKSIDM ETLETISPFT       480
     LAPWEERVQG DGQNVPETQT ETGGIMRIAV SSSARNGMVG FGVAIEKQPP RYRKPRLKTF       540
     SVTLGARIEQ NPYSGELAAM AYALGTLRVT LLTSNKAAAL TLKDPRQQSG QEHICQAYKL       600
     IKRLRKHENR INNCWVPTSE DNQLLGLAKE QARTATQEDS TPQAQVPRVK STTLNISRSQ       660
     AVPKNCLPEN VGKHSKRVDA ALPGKHTRQL YDRLSWKEAS VLAQLRTGMA RLNGYLYRIN       720
     VAESDQCACG QARETVEHFL FRCQRWTTHR TEMLQCTHTH RGNISFFLGG KSPLDDQNWK       780
     PNLEAVRATI RFAIATGRLD AA                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page