(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE50

PENCW_10.PE50        Location/Qualifiers
FT   CDS             join(115315..115574,115660..115756)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671896"
FT                   /orf_name="Pc13g00500"
FT                   /product="Putative uncharacterized protein Pc13g00500 "
FT                   /protein_id="CAP91119.1"
FT                   /db_xref="UniParc:UPI0001830E98"
FT                   /db_xref="UniProtKB/TrEMBL:B6H188"
FT                   /transl_table=1
FT                   /translation="MSIVPTAHPSVLSTNMHWSSDNLESLLGQIIGDPTHHLKCRWAED
FT                   NGVRCQNLVSKDSRIDGAICLKMFQDLPTGHSPAMGLSKAARPVKQRKLLKLSKMGTIS
FT                   LFYRHTAGRLACPT"
     MSIVPTAHPS VLSTNMHWSS DNLESLLGQI IGDPTHHLKC RWAEDNGVRC QNLVSKDSRI        60
     DGAICLKMFQ DLPTGHSPAM GLSKAARPVK QRKLLKLSKM GTISLFYRHT AGRLACPT         118
//

If you have problems or comments...

PBIL Back to PBIL home page