(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE500

PENCW_10.PE500       Location/Qualifiers
FT   CDS             join(1226250..1226603,1226675..1226777,1226832..1227184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076585" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15951956"
FT                   /orf_name="Pc13g05000"
FT                   /product="Pc13g05000 protein"
FT                   /protein_id="CAP91569.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830F86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E0"
FT                   /transl_table=1
FT                   /translation="MDSAELQDGTCHPRWDVLYSAAGFSPPVPETINDRASEKCNMLNP
FT                   GGVTVLRLSPDMVVKYGPHVTITEAQSMIFVAEHTKATPIPKVFAYCTYGPLNRDIDDY
FT                   GSLFDTYIFMSLVGTYMDELREIRSEPYIGSVNKGPVRDQTFDNFHVKGPFESEETFNE
FT                   TILDAYQANFPKRHIRSFLAGMLSQKRHSVCFTHADLRPQNIMVRGGSITGIIDWELSG
FT                   WYPEYWEFAKALYVWRWQNDWVDYLTKALEPYYNEYAVHSFVAEALW"
     MDSAELQDGT CHPRWDVLYS AAGFSPPVPE TINDRASEKC NMLNPGGVTV LRLSPDMVVK        60
     YGPHVTITEA QSMIFVAEHT KATPIPKVFA YCTYGPLNRD IDDYGSLFDT YIFMSLVGTY       120
     MDELREIRSE PYIGSVNKGP VRDQTFDNFH VKGPFESEET FNETILDAYQ ANFPKRHIRS       180
     FLAGMLSQKR HSVCFTHADL RPQNIMVRGG SITGIIDWEL SGWYPEYWEF AKALYVWRWQ       240
     NDWVDYLTKA LEPYYNEYAV HSFVAEALW                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page