(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE501

PENCW_10.PE501       Location/Qualifiers
FT   CDS             join(complement(1229367..1229519),
FT                   complement(1229252..1229308),complement(1229100..1229193),
FT                   complement(1228903..1229040),complement(1227704..1228848))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672741"
FT                   /orf_name="Pc13g05010"
FT                   /product="Pc13g05010 protein"
FT                   /function="glycine hydroxymethyltransferase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="L-serine metabolic process "
FT                   /biological_process="glycine metabolic process "
FT                   /protein_id="CAP91570.1"
FT                   /db_xref="GO:0004372"
FT                   /db_xref="GO:0006544"
FT                   /db_xref="GO:0006563"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniParc:UPI0001830F87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E1"
FT                   /transl_table=1
FT                   /translation="MYLSRCGRSAARLLPLGSSRAAVVSARASIVPRLAPQSRGVATST
FT                   RDTQHKLLAASLEESDPTVWNILQKEKQRQKHFINLIPSENFTSQAVLDALGSVMQNKY
FT                   SEGYPGARYYGGNEHIDASERLCQQRALETFRLNPEEWGVNVQPLSGSPANLMAYSALL
FT                   NTHDRIMGLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSAT
FT                   LYRPKLIIAGTSAYSRLIDYPRMRAIADSVGAYLLADMAHISGLVAADVLPSPFPYSDV
FT                   VTTTTHKSLRGPRGAMIFYRKGVRSTDKKGNPVMYDLENPINASVFPGHQGGPHNHTIT
FT                   ALSVALKQAQSPDFEAYQKTVLRNASALAGRLGDSTSNGGLGYNIVSGGTDNHLVLVDL
FT                   KNRGVDGARVERVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVA
FT                   DIVDRAVTITQKLDKAARESAQSRGVKNPNTVKAFLDYVGEGEEISEIVVLRQEVEDWV
FT                   GTFSLPWADDQ"
     MYLSRCGRSA ARLLPLGSSR AAVVSARASI VPRLAPQSRG VATSTRDTQH KLLAASLEES        60
     DPTVWNILQK EKQRQKHFIN LIPSENFTSQ AVLDALGSVM QNKYSEGYPG ARYYGGNEHI       120
     DASERLCQQR ALETFRLNPE EWGVNVQPLS GSPANLMAYS ALLNTHDRIM GLDLPHGGHL       180
     SHGYQTPTKK ISAISKYFET FPYRLDESTG LIDYDALEKS ATLYRPKLII AGTSAYSRLI       240
     DYPRMRAIAD SVGAYLLADM AHISGLVAAD VLPSPFPYSD VVTTTTHKSL RGPRGAMIFY       300
     RKGVRSTDKK GNPVMYDLEN PINASVFPGH QGGPHNHTIT ALSVALKQAQ SPDFEAYQKT       360
     VLRNASALAG RLGDSTSNGG LGYNIVSGGT DNHLVLVDLK NRGVDGARVE RVLELCGVAS       420
     NKNTVPGDKS ALKPGGLRLG TPAMTSRGFQ PEDFTRVADI VDRAVTITQK LDKAARESAQ       480
     SRGVKNPNTV KAFLDYVGEG EEISEIVVLR QEVEDWVGTF SLPWADDQ                    528
//

If you have problems or comments...

PBIL Back to PBIL home page