(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE503

PENCW_10.PE503       Location/Qualifiers
FT   CDS             join(1233194..1233337,1233388..1233470,1233528..1233771)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129810"
FT                   /orf_name="Pc13g05030"
FT                   /product="Pc13g05030 protein"
FT                   /protein_id="CAP91572.1"
FT                   /db_xref="UniParc:UPI0001830F89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E3"
FT                   /transl_table=1
FT                   /translation="MRFSIAALTLGAAGAMAGVVTETVTEYTTYCPEATSVVHGSKTYS
FT                   ISTPGYITMSHGPYTVTRPLVTSTVTECNSCSSTPAVSTPVASSSVPLIPVVPSVATST
FT                   PLVPSAGSTGVPSAPSSAATPSQPAFNAGAINAATGAGAGLAAVFGAVALLL"
     MRFSIAALTL GAAGAMAGVV TETVTEYTTY CPEATSVVHG SKTYSISTPG YITMSHGPYT        60
     VTRPLVTSTV TECNSCSSTP AVSTPVASSS VPLIPVVPSV ATSTPLVPSA GSTGVPSAPS       120
     SAATPSQPAF NAGAINAATG AGAGLAAVFG AVALLL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page