(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE504

PENCW_10.PE504       Location/Qualifiers
FT   CDS             join(1234400..1234468,1234592..1235413)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978597"
FT                   /orf_name="Pc13g05040"
FT                   /product="Putative uncharacterized protein Pc13g05040 "
FT                   /protein_id="CAP91573.1"
FT                   /db_xref="UniParc:UPI0001830F8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E4"
FT                   /transl_table=1
FT                   /translation="MSAIPKENVQASTRLKDPTHAQQEFFDADSPESIATPATKKRKRD
FT                   GSRAKRLRMSSSMETISPGSIHSKTSETSHKRSPKESKRDNSATKSAMSREMQQCTSSE
FT                   PARLELPPKPASEQKAVNDNVFTNTNPFGLADLPPSEFVFPRDVDFDYPCDERETSYEP
FT                   VSECLPEHPQVPTPYTPVLRAGSQYNQRIWNQYGGKCETWLARQLYDELHDITTRIGDI
FT                   MCGIRLMLDMRGPSDGFEGLGEHHFEAEESHGALKGDGPEDPLELSDNDDKALFVSGTD
FT                   EPSSSDEFSGFSGDE"
     MSAIPKENVQ ASTRLKDPTH AQQEFFDADS PESIATPATK KRKRDGSRAK RLRMSSSMET        60
     ISPGSIHSKT SETSHKRSPK ESKRDNSATK SAMSREMQQC TSSEPARLEL PPKPASEQKA       120
     VNDNVFTNTN PFGLADLPPS EFVFPRDVDF DYPCDERETS YEPVSECLPE HPQVPTPYTP       180
     VLRAGSQYNQ RIWNQYGGKC ETWLARQLYD ELHDITTRIG DIMCGIRLML DMRGPSDGFE       240
     GLGEHHFEAE ESHGALKGDG PEDPLELSDN DDKALFVSGT DEPSSSDEFS GFSGDE           296
//

If you have problems or comments...

PBIL Back to PBIL home page