(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE505

PENCW_10.PE505       Location/Qualifiers
FT   CDS             complement(1235621..1236676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175373" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825431"
FT                   /orf_name="Pc13g05050"
FT                   /product="Pc13g05050 protein"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91574.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0001830F8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E5"
FT                   /transl_table=1
FT                   /translation="MSTQTTTTRNPADSMVSTWRHDRSQWNTYHWMIELLGLHLIDFDA
FT                   EVPIFSKKDKIPAIREWTVHLWILLHAAIPLAIHHAYTIYTGQNMHLIGAFALYSSAFK
FT                   LNGIHEMHIMRRLGQVYGFLDGDKHPRDEIPDVGVGKVIRELISTSTLRMVMAIFLTYR
FT                   PGETPTSLEWKWLPLEIGLYSITVDFWFYWYHRMMHSVGPLWKFHRRHHLTKHPNPLLS
FT                   AYADHEQEFMDITGIPLLAYTTLKIIGLPMGFYGWWICFQYIAFSEFIGHSGLRLHGGA
FT                   PSTVNWLLEIFDAELVIEDHDLHHRYGWRKSHNYGKQTRLWDSIFGTCHERIESVKENV
FT                   DYTNRVTMPLL"
     MSTQTTTTRN PADSMVSTWR HDRSQWNTYH WMIELLGLHL IDFDAEVPIF SKKDKIPAIR        60
     EWTVHLWILL HAAIPLAIHH AYTIYTGQNM HLIGAFALYS SAFKLNGIHE MHIMRRLGQV       120
     YGFLDGDKHP RDEIPDVGVG KVIRELISTS TLRMVMAIFL TYRPGETPTS LEWKWLPLEI       180
     GLYSITVDFW FYWYHRMMHS VGPLWKFHRR HHLTKHPNPL LSAYADHEQE FMDITGIPLL       240
     AYTTLKIIGL PMGFYGWWIC FQYIAFSEFI GHSGLRLHGG APSTVNWLLE IFDAELVIED       300
     HDLHHRYGWR KSHNYGKQTR LWDSIFGTCH ERIESVKENV DYTNRVTMPL L                351
//

If you have problems or comments...

PBIL Back to PBIL home page