(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE506

PENCW_10.PE506       Location/Qualifiers
FT   CDS             join(1238132..1238536,1238594..1239529)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672742"
FT                   /orf_name="Pc13g05060"
FT                   /product="Pc13g05060 protein"
FT                   /protein_id="CAP91575.1"
FT                   /db_xref="UniParc:UPI0001830F8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E6"
FT                   /transl_table=1
FT                   /translation="MESTKVPKRPTLRWNKCRRQVLCCLFRFFVCSKKQTEEIFSYMFR
FT                   SHLNDRGIQGFVPFATLNTQWVWMKTRRDPVWSHVHTSTVFDTDEEWKEIIARIKSAAK
FT                   TLRFELLEKTADTNISRSSSAGADDERSITLNGPAAPMLPHSFSTPETLSPMVLVSPRG
FT                   DYGFGENSRANQSIEQNVDLTIDRTIDQRNDSQNDLYNELNRPNEPVVTGHGKLCFWCK
FT                   HEGAIYDPEEELQNEVYNDSGYEDDSRGNEHDNPQDDPVMREYARGLKQFTRELHGEVP
FT                   YSDEESPDSGSEAYLMTPHEGLSNVRHFCDPHISSLSNLEQEPLDSEDNSDWCADRESP
FT                   VDLTGFGTPSISEDQNGSLVDERISAREALSRFRFPHTRAGRDETPDDGLSRRASRYEW
FT                   PPNDEIMVETLRQLSVEALRQVENQSNNRTHQEMDVLMYDGNTWNQV"
     MESTKVPKRP TLRWNKCRRQ VLCCLFRFFV CSKKQTEEIF SYMFRSHLND RGIQGFVPFA        60
     TLNTQWVWMK TRRDPVWSHV HTSTVFDTDE EWKEIIARIK SAAKTLRFEL LEKTADTNIS       120
     RSSSAGADDE RSITLNGPAA PMLPHSFSTP ETLSPMVLVS PRGDYGFGEN SRANQSIEQN       180
     VDLTIDRTID QRNDSQNDLY NELNRPNEPV VTGHGKLCFW CKHEGAIYDP EEELQNEVYN       240
     DSGYEDDSRG NEHDNPQDDP VMREYARGLK QFTRELHGEV PYSDEESPDS GSEAYLMTPH       300
     EGLSNVRHFC DPHISSLSNL EQEPLDSEDN SDWCADRESP VDLTGFGTPS ISEDQNGSLV       360
     DERISAREAL SRFRFPHTRA GRDETPDDGL SRRASRYEWP PNDEIMVETL RQLSVEALRQ       420
     VENQSNNRTH QEMDVLMYDG NTWNQV                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page