(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE507

PENCW_10.PE507       Location/Qualifiers
FT   CDS             join(complement(1240971..1241365),
FT                   complement(1240812..1240919),complement(1240455..1240752),
FT                   complement(1240322..1240396),complement(1239707..1240273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672743"
FT                   /orf_name="Pc13g05070"
FT                   /product="Putative uncharacterized protein Pc13g05070 "
FT                   /protein_id="CAP91576.1"
FT                   /db_xref="UniParc:UPI0001830F8D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2E7"
FT                   /transl_table=1
FT                   /translation="MSDNPGDGKNPRRARKPQGFFSERQQEQRNAAARGQLEVDLPIRP
FT                   KDKRAAPDDSQAESSPKKKQKKEATKPKPLDVKAFMDDLKTDYSKRRLKPMPPRPPKQK
FT                   WRPVKTAITDRAKAPKGWNPREPDLINDDLQSQITRCRERIKENIMPHVYEHKLEELLV
FT                   GQERDKKMAAEKGLSWPVVRRLEDLQSILEWAQSNAIKDKYKIANNVQNVILAYRSGGL
FT                   DWCHGFVTYWHNGAQLCAPRPFKWDEFQYLYDEYKGNETGFWVEGIDGPGPSSQQAVIE
FT                   CGTGSRKWAAEMSISLRIPTTGGKPSPRSFEFSFKDDTGADYMVLYENDVNRLRINLQA
FT                   QGLMYPIPRLLGVLVVTLGDGSKKAMLVRELEVNMWDEHEKQYMADSWDSIPVAVLPGR
FT                   GTKRLNGPWMRWKFYTATAPDNSNRLWIYDYNPSNPLMRGPKIPTATKAQMDRALPTAH
FT                   KYESIENHPQFNPDIPSGKSII"
     MSDNPGDGKN PRRARKPQGF FSERQQEQRN AAARGQLEVD LPIRPKDKRA APDDSQAESS        60
     PKKKQKKEAT KPKPLDVKAF MDDLKTDYSK RRLKPMPPRP PKQKWRPVKT AITDRAKAPK       120
     GWNPREPDLI NDDLQSQITR CRERIKENIM PHVYEHKLEE LLVGQERDKK MAAEKGLSWP       180
     VVRRLEDLQS ILEWAQSNAI KDKYKIANNV QNVILAYRSG GLDWCHGFVT YWHNGAQLCA       240
     PRPFKWDEFQ YLYDEYKGNE TGFWVEGIDG PGPSSQQAVI ECGTGSRKWA AEMSISLRIP       300
     TTGGKPSPRS FEFSFKDDTG ADYMVLYEND VNRLRINLQA QGLMYPIPRL LGVLVVTLGD       360
     GSKKAMLVRE LEVNMWDEHE KQYMADSWDS IPVAVLPGRG TKRLNGPWMR WKFYTATAPD       420
     NSNRLWIYDY NPSNPLMRGP KIPTATKAQM DRALPTAHKY ESIENHPQFN PDIPSGKSII       480
//

If you have problems or comments...

PBIL Back to PBIL home page