(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE51

PENCW_10.PE51        Location/Qualifiers
FT   CDS             join(complement(117225..117313),complement(117129..117162),
FT                   complement(116626..116985))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977824"
FT                   /orf_name="Pc13g00510"
FT                   /product="Putative uncharacterized protein Pc13g00510 "
FT                   /protein_id="CAP91120.1"
FT                   /db_xref="UniParc:UPI0001830E99"
FT                   /db_xref="UniProtKB/TrEMBL:B6H189"
FT                   /transl_table=1
FT                   /translation="MQTSGSRTVSNLDRLTVYGPKELKRTVHDPAIYTSPTSVAREYLR
FT                   LLARLDSRAVRAERAQSKLEQELSASRAAENQATEELGHVSRLADIFFELSQILGGVVD
FT                   HWLKERGTKEPGQEPESTKVMLDVLLKQLEAQEFANSGEKSGDDSESGTEAAAQRS"
     MQTSGSRTVS NLDRLTVYGP KELKRTVHDP AIYTSPTSVA REYLRLLARL DSRAVRAERA        60
     QSKLEQELSA SRAAENQATE ELGHVSRLAD IFFELSQILG GVVDHWLKER GTKEPGQEPE       120
     STKVMLDVLL KQLEAQEFAN SGEKSGDDSE SGTEAAAQRS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page