(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE52

PENCW_10.PE52        Location/Qualifiers
FT   CDS             join(118628..118783,118963..119412)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671897"
FT                   /orf_name="Pc13g01200"
FT                   /product="Putative uncharacterized protein Pc13g00520 "
FT                   /protein_id="CAP91121.1"
FT                   /db_xref="UniParc:UPI0001830502"
FT                   /db_xref="UniProtKB/TrEMBL:B6H190"
FT                   /transl_table=1
FT                   /translation="MPSRRTTSEAPADAGHGSSESDAAPKRTRRPPSTGHGGPPSGTQG
FT                   ASLHTPLRLEADKTQATAKIRQLSDTNDQNLARIQTLEFQISSLKQQQLDAVQVGNTAS
FT                   DNLLPILLEVSGNFQYAQSQLEKKIEAEKTAEKNKLTFAGFPASDVLQPSWPVYNGQMG
FT                   SLGTNSLQSYSLPLTNQQAPTQANHQPLPTASQYIPQF"
     MPSRRTTSEA PADAGHGSSE SDAAPKRTRR PPSTGHGGPP SGTQGASLHT PLRLEADKTQ        60
     ATAKIRQLSD TNDQNLARIQ TLEFQISSLK QQQLDAVQVG NTASDNLLPI LLEVSGNFQY       120
     AQSQLEKKIE AEKTAEKNKL TFAGFPASDV LQPSWPVYNG QMGSLGTNSL QSYSLPLTNQ       180
     QAPTQANHQP LPTASQYIPQ F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page