(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE53

PENCW_10.PE53        Location/Qualifiers
FT   CDS             join(124917..126780,126842..127294,127657..127882,
FT                   127928..128045)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948701"
FT                   /orf_name="Pc13g00530"
FT                   /product="Pc13g00530 protein"
FT                   /protein_id="CAP91122.1"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI0001830E9A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H191"
FT                   /transl_table=1
FT                   /translation="MPGGHPTTTAIQNDLAEILLGLFIPWQNLQSLFHQTRTGSATTVD
FT                   LHHIWMSIEPTLSSYVRTFAQNIELLRKSKTDCQADAILRDRSAQNTSSVDQDLTSPPY
FT                   PISDSENESIRFSQHVDDSISKETLLAAFFAIGRGWSNEANDAQRRIPTLTSTSLPSSP
FT                   LQFDNFGPIPISNSTLYESTGLQFFPLFTLQEWKTRLQNITKAVNQDTQPGMPTTTASD
FT                   LDDFNLGMADDVLVPILTEPDLSLDLQHRRSEIGQNPTGASLTSLVRDIIPLNEKQRLV
FT                   VERVISNLLACVNHPYDSSMRQQTLLYVGGEGGVGKSQIIKAIVAVMDLIHRKDEVILM
FT                   APTGAAADVIGGSTYHTSLGISLNRYRRGGVAPRVRSLWSRKTVMIIDEVSMIDLSALS
FT                   IINTHCKIARSLDRSSPHLFGGLPVVILMGDFHQFPPVQGQALWKLPRNDTEQDGKLIW
FT                   NQFQQVIILHEQMRQAEDIPYQNLLGRARSGTLTSDDLSTLNSKAITSLTDPHLQPATV
FT                   IVKLNSLRHVINRLQIERFARARHQNIFVFPALHTRTRSSGPTSLQLRADDLLGLPEQG
FT                   AKVPFPGLILYTLSMPTMVLTNICTPAGLVNGATGQAMGIAIDPQAEFLKLDDLYIFCT
FT                   KPPVCLLFKPARTQSNLFQSLDSGILPIFPLEMSITVKGYSVRRKQIPICPAFCLTDYK
FT                   IQGATLDSVILDLKDDTKSRRQESHRKYCSTYVQLSRLRSLHGLHLLQSISMSDLEHRP
FT                   DPQLLEEMRRLQTLQEQTLGLSLQLRVSLNIPSQDIHSDDVEQNEIPTLIRFFNEGNRP
FT                   DLYQPNAFVYSSGSFPTTSSEDEGFHIVLHAHNLDRHPGNQEDTASYFMHCPGAAQPIV
FT                   TFLGVAASFLSGVVT"
     MPGGHPTTTA IQNDLAEILL GLFIPWQNLQ SLFHQTRTGS ATTVDLHHIW MSIEPTLSSY        60
     VRTFAQNIEL LRKSKTDCQA DAILRDRSAQ NTSSVDQDLT SPPYPISDSE NESIRFSQHV       120
     DDSISKETLL AAFFAIGRGW SNEANDAQRR IPTLTSTSLP SSPLQFDNFG PIPISNSTLY       180
     ESTGLQFFPL FTLQEWKTRL QNITKAVNQD TQPGMPTTTA SDLDDFNLGM ADDVLVPILT       240
     EPDLSLDLQH RRSEIGQNPT GASLTSLVRD IIPLNEKQRL VVERVISNLL ACVNHPYDSS       300
     MRQQTLLYVG GEGGVGKSQI IKAIVAVMDL IHRKDEVILM APTGAAADVI GGSTYHTSLG       360
     ISLNRYRRGG VAPRVRSLWS RKTVMIIDEV SMIDLSALSI INTHCKIARS LDRSSPHLFG       420
     GLPVVILMGD FHQFPPVQGQ ALWKLPRNDT EQDGKLIWNQ FQQVIILHEQ MRQAEDIPYQ       480
     NLLGRARSGT LTSDDLSTLN SKAITSLTDP HLQPATVIVK LNSLRHVINR LQIERFARAR       540
     HQNIFVFPAL HTRTRSSGPT SLQLRADDLL GLPEQGAKVP FPGLILYTLS MPTMVLTNIC       600
     TPAGLVNGAT GQAMGIAIDP QAEFLKLDDL YIFCTKPPVC LLFKPARTQS NLFQSLDSGI       660
     LPIFPLEMSI TVKGYSVRRK QIPICPAFCL TDYKIQGATL DSVILDLKDD TKSRRQESHR       720
     KYCSTYVQLS RLRSLHGLHL LQSISMSDLE HRPDPQLLEE MRRLQTLQEQ TLGLSLQLRV       780
     SLNIPSQDIH SDDVEQNEIP TLIRFFNEGN RPDLYQPNAF VYSSGSFPTT SSEDEGFHIV       840
     LHAHNLDRHP GNQEDTASYF MHCPGAAQPI VTFLGVAASF LSGVVT                      886
//

If you have problems or comments...

PBIL Back to PBIL home page