(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE55

PENCW_10.PE55        Location/Qualifiers
FT   CDS             join(129330..129452,129547..130191)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824592"
FT                   /orf_name="Pc13g00550"
FT                   /product="Pc13g00550 protein"
FT                   /protein_id="CAP91124.1"
FT                   /db_xref="UniParc:UPI0001830E9C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H193"
FT                   /transl_table=1
FT                   /translation="MTKYRHWVPFQLGRMFRLLYEFNYTPQIRAFITLIPIPRTREYIQ
FT                   QLEQQLRSFQRLGVAATQDVQKAGRKVAAENASLRSLLMIHGVTKIQIEEYLESQRQTA
FT                   SSIQSQYPSVVSLPSTNLHRPTADGQPSVDHHHSLSSQEVNSTSHPPKTLEVRSSPPRS
FT                   DPKISMNISNRQESSAGRAVELGSVTAETVPDSQHFGGVQDTGQFTSCVTAASLIESIR
FT                   NHSDFRDVRSELGCDSEPNCMVKNMSIFDILDR"
     MTKYRHWVPF QLGRMFRLLY EFNYTPQIRA FITLIPIPRT REYIQQLEQQ LRSFQRLGVA        60
     ATQDVQKAGR KVAAENASLR SLLMIHGVTK IQIEEYLESQ RQTASSIQSQ YPSVVSLPST       120
     NLHRPTADGQ PSVDHHHSLS SQEVNSTSHP PKTLEVRSSP PRSDPKISMN ISNRQESSAG       180
     RAVELGSVTA ETVPDSQHFG GVQDTGQFTS CVTAASLIES IRNHSDFRDV RSELGCDSEP       240
     NCMVKNMSIF DILDR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page