(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE56

PENCW_10.PE56        Location/Qualifiers
FT   CDS             complement(130867..131547)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209538" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824593"
FT                   /orf_name="Pc13g00560"
FT                   /product="Pc13g00560 protein"
FT                   /protein_id="CAP91125.1"
FT                   /db_xref="InterPro:IPR012389"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI0001830E9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H137"
FT                   /transl_table=1
FT                   /translation="MSNNFQRKSQDDAHSPNGPLVYRLYSKLNISQLGQRWHPRSDVKL
FT                   LPAKYELTEPSDLVVLISSMLMQLIRINDKMPLQQGQQTRFHSRTAPQIPVFNYLQRLA
FT                   THAKLPSAILLSMVYYIDRLCMLYPAFTVSSLTIHRFLIVSAAVASKGLSDSFWTNKTY
FT                   AQIGGISTMELAMLELDFLFRMEWQIVPQPEVLTDYYRHLVDRCESFKINEPNSNISTV
FT                   SVLR"
     MSNNFQRKSQ DDAHSPNGPL VYRLYSKLNI SQLGQRWHPR SDVKLLPAKY ELTEPSDLVV        60
     LISSMLMQLI RINDKMPLQQ GQQTRFHSRT APQIPVFNYL QRLATHAKLP SAILLSMVYY       120
     IDRLCMLYPA FTVSSLTIHR FLIVSAAVAS KGLSDSFWTN KTYAQIGGIS TMELAMLELD       180
     FLFRMEWQIV PQPEVLTDYY RHLVDRCESF KINEPNSNIS TVSVLR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page