(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE57

PENCW_10.PE57        Location/Qualifiers
FT   CDS             join(complement(133640..133922),complement(133446..133588),
FT                   complement(133311..133397),complement(132590..133246))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128942"
FT                   /orf_name="Pc13g00570"
FT                   /product="Pc13g00570 protein"
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91126.1"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="UniParc:UPI0001830E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H138"
FT                   /transl_table=1
FT                   /translation="MAAPTGRHPTKESEYHNSILHSQPPTPTAEDVEKQESEESTAKQS
FT                   AFKGLGWLDRFLALWIFLAMAVGIILGNFVENTGPALQKGKFVGVSIPIAIGLLVMMYP
FT                   ILCKVRYESLHHVFRERGVWIQIGFSIFINWIIAPLLMLALAWAFLPDEPELREGLILV
FT                   GLARCIAMVLIWTGLAGGDNEYCAILVAVNSLLQMVLFAPLAILFIKVIGHSGSQVTLS
FT                   YSTAAKSVAVFLGIPLGAAIITRIVLRKITSPRWYDQVFLKWAGPWSLIGLLFTILVLF
FT                   ASQGRQVVHQIVSVVRVAAPLIVYFIVVFFITLLVTYKLGFGYKLSATQSFTAASNNFE
FT                   LAIAVAVATFGANSNQALAATVGPLIEVPVLLGLVYVAKFIAKRAGWKD"
     MAAPTGRHPT KESEYHNSIL HSQPPTPTAE DVEKQESEES TAKQSAFKGL GWLDRFLALW        60
     IFLAMAVGII LGNFVENTGP ALQKGKFVGV SIPIAIGLLV MMYPILCKVR YESLHHVFRE       120
     RGVWIQIGFS IFINWIIAPL LMLALAWAFL PDEPELREGL ILVGLARCIA MVLIWTGLAG       180
     GDNEYCAILV AVNSLLQMVL FAPLAILFIK VIGHSGSQVT LSYSTAAKSV AVFLGIPLGA       240
     AIITRIVLRK ITSPRWYDQV FLKWAGPWSL IGLLFTILVL FASQGRQVVH QIVSVVRVAA       300
     PLIVYFIVVF FITLLVTYKL GFGYKLSATQ SFTAASNNFE LAIAVAVATF GANSNQALAA       360
     TVGPLIEVPV LLGLVYVAKF IAKRAGWKD                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page