(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE58

PENCW_10.PE58        Location/Qualifiers
FT   CDS             join(134893..135215,135356..135408,135572..135603)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000273093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824594"
FT                   /orf_name="Pc13g00580"
FT                   /product="Pc13g00580 protein"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAP91127.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="UniParc:UPI0001830E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H139"
FT                   /transl_table=1
FT                   /translation="MAKPSVLFVCVHNAGRSQMAAGYLMHLAGDTIEVRSAGSAPADSI
FT                   NPVVVEAMREEGIDLSNQKPKILTADAVQDSDVVITMGCGDVCPFFAGKRYLDWQLNDP
FT                   AGQGVLGEQPLCGGWPLVALLTSVCPYKDAG"
     MAKPSVLFVC VHNAGRSQMA AGYLMHLAGD TIEVRSAGSA PADSINPVVV EAMREEGIDL        60
     SNQKPKILTA DAVQDSDVVI TMGCGDVCPF FAGKRYLDWQ LNDPAGQGVL GEQPLCGGWP       120
     LVALLTSVCP YKDAG                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page