(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE6

PENCW_10.PE6         Location/Qualifiers
FT   CDS             complement(17001..17153)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671646"
FT                   /orf_name="Pc13g00060"
FT                   /product="Pc13g00060 protein"
FT                   /protein_id="CAP91075.1"
FT                   /db_xref="UniParc:UPI0001830CF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H3"
FT                   /transl_table=1
FT                   /translation="MDWRYNVTVSIADWALLAGYLVIPGTFTSLKESSQVEEILKTNNA
FT                   GRAVL"
     MDWRYNVTVS IADWALLAGY LVIPGTFTSL KESSQVEEIL KTNNAGRAVL                   50
//

If you have problems or comments...

PBIL Back to PBIL home page