(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE60

PENCW_10.PE60        Location/Qualifiers
FT   CDS             join(complement(142177..142532),complement(141890..142115),
FT                   complement(141771..141830),complement(141426..141716),
FT                   complement(141141..141369),complement(140929..141088),
FT                   complement(138607..140872))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824596"
FT                   /orf_name="Pc13g00600"
FT                   /product="Pc13g00600 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91129.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830F60"
FT                   /db_xref="UniProtKB/TrEMBL:B6H141"
FT                   /transl_table=1
FT                   /translation="MASQKKWYVFRVTGLSRERPDGDLETTLQEAIDDNFADDETSHIK
FT                   PEIKIVPSCYESDTERAALVQFRGGVPQFLAELRVNPLGDWQIEMGDDDISFDCHFFGF
FT                   TQLYMPDGNKPVIADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELIEEIKKIRNTKELQQRPLIFIAHSFGGIIVAHCLVKAIQT
FT                   MEGDHPAITSLYQATYGMILFAIPHKGLMMDDIQQMLAGDQSHPRERLLQQISSKSDLL
FT                   IHQLADFKNLIRDRKVVSFYETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDH
FT                   VEDKVPLHADHSMVVKFNTRNAAGYRTAVDKLRQFLKDAPSMVAARFTQTRPKPQPCST
FT                   VPFKKDPMFVGREVVISAINERYRAIGQRHERVGLVGLAGVGKTQTAIEYSYRVRESTP
FT                   DTWVFWIHASNTARLEQGYQQIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLVVLD
FT                   NADDDGIFFSDNTFNERGPLVSFLPQAAHGSMLITSRNGLAARNLVGSESHVIRVQPMN
FT                   EAESLSLLRARIPAPQSGESGESGGNERALVQALECIPLAITQAAAYIANRLPLVTVTE
FT                   YLRLFHESESKRTRLLQNEDSADLRRDPSIRYAVITTWQLSFEQIRQERPTATDLLALM
FT                   SMFDRQGIPEDLVRDHNQDILDFHDALAPLLSYSLIRLEINERLFDMHRLVQLSVRAWL
FT                   DMHQQLYGWQAKSRQIMARVFPGGEYESWSQCRSLLAHANSVLQSICDVDDEDRLNAAT
FT                   LLSNCGWFLHLQGVYEEAELMHRRALEARENALGREHPDTLTSVSDLGLVLSSQGKYDE
FT                   AEAMHRRALEARENALGREHPDTLTSVSNLGDVLSSQGVYEEAEAMHRRALEARENVLG
FT                   REHPDTLTSVSDLGNVLSSQGVYEEAEAMHRRALEARENALGREHPDTLTSVSNLGDVL
FT                   SSQGVYEEAEAMHRRALEARENVLGREHPDTLTSVSDLGNVLSSQGKYDEAEAMHRRAL
FT                   EARENVLGREHPSTLTSVNNLGLVLSSQGKYDEAEAIYLHDMEGSEKVLGCEHPNTVTS
FT                   INNLGLVLSSQGNYDEGEAMHRRALEAREKVLRREHPDTLTSVSTLGNVLSSQGKYDEA
FT                   EAIYLHDMEGSENVLGCEHPGILASLNIR"
     MASQKKWYVF RVTGLSRERP DGDLETTLQE AIDDNFADDE TSHIKPEIKI VPSCYESDTE        60
     RAALVQFRGG VPQFLAELRV NPLGDWQIEM GDDDISFDCH FFGFTQLYMP DGNKPVIADI       120
     IAIAGLDGHA YGSWQGRGNL GRMWLRDFLS KDLPQCRTMI YGYNSKLSSH GVDTILDYGR       180
     ELIEEIKKIR NTKELQQRPL IFIAHSFGGI IVAHCLVKAI QTMEGDHPAI TSLYQATYGM       240
     ILFAIPHKGL MMDDIQQMLA GDQSHPRERL LQQISSKSDL LIHQLADFKN LIRDRKVVSF       300
     YETEQTRQLV LDSESGRWKR TGDFVTTVGA DSALLQLPDH VEDKVPLHAD HSMVVKFNTR       360
     NAAGYRTAVD KLRQFLKDAP SMVAARFTQT RPKPQPCSTV PFKKDPMFVG REVVISAINE       420
     RYRAIGQRHE RVGLVGLAGV GKTQTAIEYS YRVRESTPDT WVFWIHASNT ARLEQGYQQI       480
     ATVAEIPGRD DPKINILQLV YQWLCDARNG RWLVVLDNAD DDGIFFSDNT FNERGPLVSF       540
     LPQAAHGSML ITSRNGLAAR NLVGSESHVI RVQPMNEAES LSLLRARIPA PQSGESGESG       600
     GNERALVQAL ECIPLAITQA AAYIANRLPL VTVTEYLRLF HESESKRTRL LQNEDSADLR       660
     RDPSIRYAVI TTWQLSFEQI RQERPTATDL LALMSMFDRQ GIPEDLVRDH NQDILDFHDA       720
     LAPLLSYSLI RLEINERLFD MHRLVQLSVR AWLDMHQQLY GWQAKSRQIM ARVFPGGEYE       780
     SWSQCRSLLA HANSVLQSIC DVDDEDRLNA ATLLSNCGWF LHLQGVYEEA ELMHRRALEA       840
     RENALGREHP DTLTSVSDLG LVLSSQGKYD EAEAMHRRAL EARENALGRE HPDTLTSVSN       900
     LGDVLSSQGV YEEAEAMHRR ALEARENVLG REHPDTLTSV SDLGNVLSSQ GVYEEAEAMH       960
     RRALEARENA LGREHPDTLT SVSNLGDVLS SQGVYEEAEA MHRRALEARE NVLGREHPDT      1020
     LTSVSDLGNV LSSQGKYDEA EAMHRRALEA RENVLGREHP STLTSVNNLG LVLSSQGKYD      1080
     EAEAIYLHDM EGSEKVLGCE HPNTVTSINN LGLVLSSQGN YDEGEAMHRR ALEAREKVLR      1140
     REHPDTLTSV STLGNVLSSQ GKYDEAEAIY LHDMEGSENV LGCEHPGILA SLNIR           1195
//

If you have problems or comments...

PBIL Back to PBIL home page