(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE62

PENCW_10.PE62        Location/Qualifiers
FT   CDS             join(complement(156706..157073),complement(156419..156644),
FT                   complement(155952..156242),complement(155670..155898),
FT                   complement(155446..155605),complement(152801..155387))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977826"
FT                   /orf_name="Pc13g00620"
FT                   /product="Pc13g00620 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91131.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830F61"
FT                   /db_xref="UniProtKB/TrEMBL:B6H150"
FT                   /transl_table=1
FT                   /translation="MANQRKSHVFRVTGLSIKLPDGDLKTDEDFRTALYGTLNDNFIDD
FT                   ENSQIKSDITIVPSCYESDTQRVALVQFRGGMPQFLRDHDPLGDWQVEIGDDDISFDCH
FT                   FFGFTQLYTLDENKPVDADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTM
FT                   IYGYNSKLSSPGVNTILDYGRELMEEIKKIRNTKECLVRAIQTLEEDHPAITSLHRATY
FT                   GMILFAIPHKGLVMDDIQQMLGGDGHHPREKLLRQISSQSDVLIHQLADFKNLIRDRKV
FT                   VSFYETEQTKRLVLDLESGCWKRTGDFMTTVDADSALLQLPDHIEDKVPLHADHSMIVK
FT                   FDTRNAAGYRTALDKLRQLSKDAPAVVAARFAQTRQKPQPCSTVPFERDPVFVGRKYEI
FT                   NAIEKKHGTIGQRHERVALVGLAGVGKTQTAIEYSYCVRESTPDMWVFWIHASNLERLE
FT                   QGYRQIAAVTEIPGRDDPKINILQLVYQWLCDARNGRWLIVLDNADDDSIFFRENESKE
FT                   RGPLVNFLPQAAHGSMLITSRNGRAARNLVGRNSHVIEVQPMNEEESVALLRRWIPAPQ
FT                   SGDFGESGEDEKALVQALEYIPLAITQAGSYIANRLPLITVTAYLRLFHESESKRTRLL
FT                   KNEDSTDLRRDPSIRYAVITTWQISFEQIRQERPVASDLLALMSMFDRQGIPVDLVRES
FT                   EQDELDFHDALVPLLNYSLIRLEINERLFDMHRLVQLSVRAWLEMHQQLYSWQAKSREI
FT                   MARVFPDGEYESWTQCRSLLAHAKSVLNSIYDVEGEDRLNTATLLSNCGWFLNLQGAYE
FT                   EAELMHRRALEAREKVLGREHPSTLISVNNLGLVLSKQGQYDEAEAMHRRALEAREKVL
FT                   GREHPDTLTSVNNLGLVLSNQGKYEEAGAMHQRALEAREKVLGREHPSTLGSVSNLGNV
FT                   LGRQGKYEEAEAMYRRALKAREKVLGREHPDTLIGVSNLGVVLFKQGQYEEAEAIYRRA
FT                   LKAREKVLGREHPDTLTSVNNLGDVLSKQGKYEEAEAMHRGALEVKEKVLGREHPSTLI
FT                   SVNNLGLVLTKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGLVLKSQGKYKE
FT                   AEAMYRRALEARQKVLGQEHPDTLGSVNNFASVLSKQGQYKEAEAMYRRALDGYEKVLG
FT                   REHPDTLMSVNNLGSVLFKQGQYEEAEAMYRRALEARQKVLGREHPDTLTSVNNLGDVL
FT                   SKQGRHEEAEAMHRWAQTVDSSTLMQQGILLKNIFSTPHPLLQLSLRHHRSLEEKHDRD
FT                   VD"
     MANQRKSHVF RVTGLSIKLP DGDLKTDEDF RTALYGTLND NFIDDENSQI KSDITIVPSC        60
     YESDTQRVAL VQFRGGMPQF LRDHDPLGDW QVEIGDDDIS FDCHFFGFTQ LYTLDENKPV       120
     DADIIAIAGL DGHAYGSWQG RGNLGRMWLR DFLSKDLPQC RTMIYGYNSK LSSPGVNTIL       180
     DYGRELMEEI KKIRNTKECL VRAIQTLEED HPAITSLHRA TYGMILFAIP HKGLVMDDIQ       240
     QMLGGDGHHP REKLLRQISS QSDVLIHQLA DFKNLIRDRK VVSFYETEQT KRLVLDLESG       300
     CWKRTGDFMT TVDADSALLQ LPDHIEDKVP LHADHSMIVK FDTRNAAGYR TALDKLRQLS       360
     KDAPAVVAAR FAQTRQKPQP CSTVPFERDP VFVGRKYEIN AIEKKHGTIG QRHERVALVG       420
     LAGVGKTQTA IEYSYCVRES TPDMWVFWIH ASNLERLEQG YRQIAAVTEI PGRDDPKINI       480
     LQLVYQWLCD ARNGRWLIVL DNADDDSIFF RENESKERGP LVNFLPQAAH GSMLITSRNG       540
     RAARNLVGRN SHVIEVQPMN EEESVALLRR WIPAPQSGDF GESGEDEKAL VQALEYIPLA       600
     ITQAGSYIAN RLPLITVTAY LRLFHESESK RTRLLKNEDS TDLRRDPSIR YAVITTWQIS       660
     FEQIRQERPV ASDLLALMSM FDRQGIPVDL VRESEQDELD FHDALVPLLN YSLIRLEINE       720
     RLFDMHRLVQ LSVRAWLEMH QQLYSWQAKS REIMARVFPD GEYESWTQCR SLLAHAKSVL       780
     NSIYDVEGED RLNTATLLSN CGWFLNLQGA YEEAELMHRR ALEAREKVLG REHPSTLISV       840
     NNLGLVLSKQ GQYDEAEAMH RRALEAREKV LGREHPDTLT SVNNLGLVLS NQGKYEEAGA       900
     MHQRALEARE KVLGREHPST LGSVSNLGNV LGRQGKYEEA EAMYRRALKA REKVLGREHP       960
     DTLIGVSNLG VVLFKQGQYE EAEAIYRRAL KAREKVLGRE HPDTLTSVNN LGDVLSKQGK      1020
     YEEAEAMHRG ALEVKEKVLG REHPSTLISV NNLGLVLTKQ GQYEEAEAMY RRALEARQKV      1080
     LGREHPDTLT SVNNLGLVLK SQGKYKEAEA MYRRALEARQ KVLGQEHPDT LGSVNNFASV      1140
     LSKQGQYKEA EAMYRRALDG YEKVLGREHP DTLMSVNNLG SVLFKQGQYE EAEAMYRRAL      1200
     EARQKVLGRE HPDTLTSVNN LGDVLSKQGR HEEAEAMHRW AQTVDSSTLM QQGILLKNIF      1260
     STPHPLLQLS LRHHRSLEEK HDRDVD                                           1286
//

If you have problems or comments...

PBIL Back to PBIL home page