(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE64

PENCW_10.PE64        Location/Qualifiers
FT   CDS             complement(<160324..>161142)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948702"
FT                   /orf_name="Pc13g00640"
FT                   /product="Pc13g00640 protein"
FT                   /protein_id="CAP91133.1"
FT                   /db_xref="UniParc:UPI0001830F62"
FT                   /db_xref="UniProtKB/TrEMBL:B6H151"
FT                   /transl_table=1
FT                   /translation="DLDTSLDYLPGHPRIKLGDEKGLFDFIRREVWSEDLESISGRLWW
FT                   MSKQDGSNISPLHRQRVKGRQIIVTEDPRLHLVWIDDRIFLKTLPQYIMSYVFWDTFLS
FT                   DPSKYGAEVKLRMAALGYLRTYFYLIQHESDLRIAKDPALSLVPKEVTWPQFCQFTACF
FT                   HNITDHEVSERYHYGEIRLTRLNYYAPVLLGKGHYQRVNHQYRAYFARIQGPVISAFAF
FT                   FSILLNCMQVSLAASASDERYSSAPLFASCYWFSTVIGLLTGVLLLMLVLL"
     DLDTSLDYLP GHPRIKLGDE KGLFDFIRRE VWSEDLESIS GRLWWMSKQD GSNISPLHRQ        60
     RVKGRQIIVT EDPRLHLVWI DDRIFLKTLP QYIMSYVFWD TFLSDPSKYG AEVKLRMAAL       120
     GYLRTYFYLI QHESDLRIAK DPALSLVPKE VTWPQFCQFT ACFHNITDHE VSERYHYGEI       180
     RLTRLNYYAP VLLGKGHYQR VNHQYRAYFA RIQGPVISAF AFFSILLNCM QVSLAASASD       240
     ERYSSAPLFA SCYWFSTVIG LLTGVLLLML VLL                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page