(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE65

PENCW_10.PE65        Location/Qualifiers
FT   CDS             complement(161665..>163221)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948703"
FT                   /orf_name="Pc13g00650"
FT                   /product="Pc13g00650 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91134.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="UniParc:UPI0001830F63"
FT                   /db_xref="UniProtKB/TrEMBL:B6H152"
FT                   /transl_table=1
FT                   /translation="HTYAIQSISTGIPASTLWRRANNRPSIADKAANQQYLTPQEEQAL
FT                   VEYVLRLADNGYPLSVKFLRSLALIIVRQRSSNFQITDPSLKVRTPGKNWPQGFYRRHP
FT                   QLKARRLRAIDWKRDGRHIEDKVRHWFDIIGRELANPAILLEVYNMDETGVLLSVLNSL
FT                   KVLVSKDDLRKHRGTTMKRTLVMAIECISADGRFLHPLIIWPAATHRSSWTTHPTPGWH
FT                   FSCSKTGYTNTEISLYWVEHVFDPQTRDRAGGRPRLLICDGFGTHESLEVMKFCFANRI
FT                   ILCRLPSHTSHKLQPCDVGVFSPLKTAYRAQIEQACRAGVSTIGKPHFTYLYDSARKEA
FT                   FTPRNIRSAWSRSGLFPFDPSRVLRECQASSEIQTTTPVEAPTVSSNICHTPNTSDSFA
FT                   LLRSEVEQDTQNLDGVCKRRLQTLSCATERVFAERALLLEENRILFEQNNEKTCRQSSG
FT                   LTVLGHAKVMSYEDIVEAQKKRDMTVTEQATREKRSKLGASCFRNRRRSARRSRRFKHG
FT                   I"
     HTYAIQSIST GIPASTLWRR ANNRPSIADK AANQQYLTPQ EEQALVEYVL RLADNGYPLS        60
     VKFLRSLALI IVRQRSSNFQ ITDPSLKVRT PGKNWPQGFY RRHPQLKARR LRAIDWKRDG       120
     RHIEDKVRHW FDIIGRELAN PAILLEVYNM DETGVLLSVL NSLKVLVSKD DLRKHRGTTM       180
     KRTLVMAIEC ISADGRFLHP LIIWPAATHR SSWTTHPTPG WHFSCSKTGY TNTEISLYWV       240
     EHVFDPQTRD RAGGRPRLLI CDGFGTHESL EVMKFCFANR IILCRLPSHT SHKLQPCDVG       300
     VFSPLKTAYR AQIEQACRAG VSTIGKPHFT YLYDSARKEA FTPRNIRSAW SRSGLFPFDP       360
     SRVLRECQAS SEIQTTTPVE APTVSSNICH TPNTSDSFAL LRSEVEQDTQ NLDGVCKRRL       420
     QTLSCATERV FAERALLLEE NRILFEQNNE KTCRQSSGLT VLGHAKVMSY EDIVEAQKKR       480
     DMTVTEQATR EKRSKLGASC FRNRRRSARR SRRFKHGI                               518
//

If you have problems or comments...

PBIL Back to PBIL home page