(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE68

PENCW_10.PE68        Location/Qualifiers
FT   CDS             join(complement(170170..170323),complement(169867..170134),
FT                   complement(169794..169811),complement(169552..169744))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948705"
FT                   /orf_name="Pc13g00680"
FT                   /product="Putative uncharacterized protein Pc13g00680 "
FT                   /protein_id="CAP91137.1"
FT                   /db_xref="UniParc:UPI0001830F66"
FT                   /db_xref="UniProtKB/TrEMBL:B6H145"
FT                   /transl_table=1
FT                   /translation="MFGYGHFSLRIFKGSNSPHFLLPSIPYFTVSPRTPCLTSRQLQWV
FT                   TKEIRSGSPEPNDIWSPRTSIAGSVDDDCHSQQTDVSDEEGKATSMDGCSDEEETQGQW
FT                   AKEHTKERALDGARSVKFLKPEDSTESMVKMIECMAELDGRVQSDAKSLEGQDRWNQGM
FT                   QRKYIDMIGAIDTLSKDVATLRKQVEALSSRDAAKTREVVGSKRQKQ"
     MFGYGHFSLR IFKGSNSPHF LLPSIPYFTV SPRTPCLTSR QLQWVTKEIR SGSPEPNDIW        60
     SPRTSIAGSV DDDCHSQQTD VSDEEGKATS MDGCSDEEET QGQWAKEHTK ERALDGARSV       120
     KFLKPEDSTE SMVKMIECMA ELDGRVQSDA KSLEGQDRWN QGMQRKYIDM IGAIDTLSKD       180
     VATLRKQVEA LSSRDAAKTR EVVGSKRQKQ                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page