(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE69

PENCW_10.PE69        Location/Qualifiers
FT   CDS             join(171241..171568,171623..171747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948706"
FT                   /orf_name="Pc13g00690"
FT                   /product="Putative uncharacterized protein Pc13g00690 "
FT                   /protein_id="CAP91138.1"
FT                   /db_xref="UniParc:UPI0001830F67"
FT                   /db_xref="UniProtKB/TrEMBL:B6H146"
FT                   /transl_table=1
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKQNYLLREYRSIQKSLPETT
FT                   SSGAVPLRVQREEARMSCLPSLPIYAPRGSRTKTRLLIHALEQLAVSERRHLTNDSDSA
FT                   NERLPGYTIRPPHTLRSAPSRHISYLWKFVHPMAAATRASRNAEIL"
     MSWKERSRAY LRQFGVKRTG EALRCKQNYL LREYRSIQKS LPETTSSGAV PLRVQREEAR        60
     MSCLPSLPIY APRGSRTKTR LLIHALEQLA VSERRHLTND SDSANERLPG YTIRPPHTLR       120
     SAPSRHISYL WKFVHPMAAA TRASRNAEIL                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page