(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE70

PENCW_10.PE70        Location/Qualifiers
FT   CDS             join(complement(172843..173005),complement(172662..172770),
FT                   complement(172326..172551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948707"
FT                   /orf_name="Pc13g00700"
FT                   /product="Putative uncharacterized protein Pc13g00700 "
FT                   /protein_id="CAP91139.1"
FT                   /db_xref="UniParc:UPI0001830F68"
FT                   /db_xref="UniProtKB/TrEMBL:B6H147"
FT                   /transl_table=1
FT                   /translation="MSYAQILRSSRQPGGYEAQIASLMPPEEEQQQTRITPFHLKGNPD
FT                   LASRAKDEKAIFAVNPAKPRVSSYRTLQWLAFCADFEIDSLHKRVKKIEHFINGITQNG
FT                   FADVLTENATLLSETTALKDKIQELEETLENMQARVDELCKERQVSTVQNNPARKKRAM
FT                   PQ"
     MSYAQILRSS RQPGGYEAQI ASLMPPEEEQ QQTRITPFHL KGNPDLASRA KDEKAIFAVN        60
     PAKPRVSSYR TLQWLAFCAD FEIDSLHKRV KKIEHFINGI TQNGFADVLT ENATLLSETT       120
     ALKDKIQELE ETLENMQARV DELCKERQVS TVQNNPARKK RAMPQ                       165
//

If you have problems or comments...

PBIL Back to PBIL home page