(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE71

PENCW_10.PE71        Location/Qualifiers
FT   CDS             join(complement(174520..174541),complement(173650..174437))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948708"
FT                   /orf_name="Pc13g00710"
FT                   /product="Pc13g00710 protein"
FT                   /protein_id="CAP91140.1"
FT                   /db_xref="UniParc:UPI0001830F69"
FT                   /db_xref="UniProtKB/TrEMBL:B6H148"
FT                   /transl_table=1
FT                   /translation="MSKTRLVASSISTYDDRVLVPGTTERCCTPPEGAQNLPHGAQGSE
FT                   GAQNLPHGAQGNEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPH
FT                   GAQGNEGAQNLPHGAQGSEGAQNLPHGAHGSEGAQNLPHGAQGNEGAQNLPHGAQGSEG
FT                   AQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHGAQGNEGAQNLPHGAQGSEGAQNLPHG
FT                   AHGSEGAQNLPHGAHGSEGGQEACSYSPKWARRAFLSVPTTRLDKYH"
     MSKTRLVASS ISTYDDRVLV PGTTERCCTP PEGAQNLPHG AQGSEGAQNL PHGAQGNEGA        60
     QNLPHGAQGN EGAQNLPHGA QGSEGAQNLP HGAHGSEGAQ NLPHGAQGNE GAQNLPHGAQ       120
     GSEGAQNLPH GAHGSEGAQN LPHGAQGNEG AQNLPHGAQG SEGAQNLPHG AQGNEGAQNL       180
     PHGAQGSEGA QNLPHGAQGN EGAQNLPHGA QGSEGAQNLP HGAHGSEGAQ NLPHGAHGSE       240
     GGQEACSYSP KWARRAFLSV PTTRLDKYH                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page