(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE72

PENCW_10.PE72        Location/Qualifiers
FT   CDS             join(176999..177032,177089..177328,177465..179262,
FT                   179303..179318,179494..180063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824597"
FT                   /orf_name="Pc13g00720"
FT                   /product="Putative uncharacterized protein Pc13g00720 "
FT                   /protein_id="CAP91141.1"
FT                   /db_xref="UniParc:UPI0001830F6A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H149"
FT                   /transl_table=1
FT                   /translation="MASRVNQLASDVIKANNTVLEEILRRDRILRRNPQPSRRSAGSPF
FT                   PLESAEEPANFMQVQIDVDPPDGMAIETQRTDAQASASKRGAGTRNYKVRKNQSQEEIA
FT                   QNFHGTFTQKRTFHAIEAKVYFLTGKSHFRKRNKKTSRKRPVSLTPRSSPPPSQFSGSV
FT                   DSTQQLISRSSIEVHDLRLAPNLLPYLNSEDCEDGDSYGLHGVQPVDPERETSDLHAVP
FT                   EQDTANQMLSCQRAPQEREPQSGTSQNESPVRGSRQAEESPKAHPGFSDLVGESQPRNG
FT                   NPTNVFAAISKMGDACLPRSSPLEPPRISEPIQSPIRHPPEDDITLEWLGQTLSCCAET
FT                   STMHMEQADTAHGNQSLETLSPQSSSRENSLTRGSENEGFNDESHTESVPRSPTPFQVP
FT                   EPSSTGNSTEHHPQNCGMDEPTIDASESAFIDKKLIIRCLHEKSKSQAARSHPNWNHKD
FT                   LNRLLGWHMKRKNLPKERLEVEFLRDFGHYRSSSAIVTACRRKRKADSRHKDVTSAPTP
FT                   GRLTPLAPVLNTKPVSRPPNAIIGSDTPSLHSSHTAAVPSNENTTLKPPPLERSRSRHL
FT                   TQPQILGNIDRFSRDMAPPLHESDETVDQSSPAAVAPESASGQMVCWTPDSAEDTPTLG
FT                   NRRHRVEITPKPPSRFTAINGGNVHPADPNSTAQPETNKRDAVPNGQGGQRASKEKKKG
FT                   SRLTPEHELAGSNNSKRSAGTSEGAENQRSLPIDVSDANIAQLGMRTDLQNTSQSQERD
FT                   VDIPPKNNSQLTYIQNPDPNCPPNSQVANTRPSHFCRPNSQSGASQTSGVSGSAHTGGL
FT                   FTPHTSGPAYPDMRPEAIVPISVSASFLSSPTCLPHYPLHVLQGGGAERYQGPPLPSLA
FT                   QQMYYHRTGEPLHK"
     MASRVNQLAS DVIKANNTVL EEILRRDRIL RRNPQPSRRS AGSPFPLESA EEPANFMQVQ        60
     IDVDPPDGMA IETQRTDAQA SASKRGAGTR NYKVRKNQSQ EEIAQNFHGT FTQKRTFHAI       120
     EAKVYFLTGK SHFRKRNKKT SRKRPVSLTP RSSPPPSQFS GSVDSTQQLI SRSSIEVHDL       180
     RLAPNLLPYL NSEDCEDGDS YGLHGVQPVD PERETSDLHA VPEQDTANQM LSCQRAPQER       240
     EPQSGTSQNE SPVRGSRQAE ESPKAHPGFS DLVGESQPRN GNPTNVFAAI SKMGDACLPR       300
     SSPLEPPRIS EPIQSPIRHP PEDDITLEWL GQTLSCCAET STMHMEQADT AHGNQSLETL       360
     SPQSSSRENS LTRGSENEGF NDESHTESVP RSPTPFQVPE PSSTGNSTEH HPQNCGMDEP       420
     TIDASESAFI DKKLIIRCLH EKSKSQAARS HPNWNHKDLN RLLGWHMKRK NLPKERLEVE       480
     FLRDFGHYRS SSAIVTACRR KRKADSRHKD VTSAPTPGRL TPLAPVLNTK PVSRPPNAII       540
     GSDTPSLHSS HTAAVPSNEN TTLKPPPLER SRSRHLTQPQ ILGNIDRFSR DMAPPLHESD       600
     ETVDQSSPAA VAPESASGQM VCWTPDSAED TPTLGNRRHR VEITPKPPSR FTAINGGNVH       660
     PADPNSTAQP ETNKRDAVPN GQGGQRASKE KKKGSRLTPE HELAGSNNSK RSAGTSEGAE       720
     NQRSLPIDVS DANIAQLGMR TDLQNTSQSQ ERDVDIPPKN NSQLTYIQNP DPNCPPNSQV       780
     ANTRPSHFCR PNSQSGASQT SGVSGSAHTG GLFTPHTSGP AYPDMRPEAI VPISVSASFL       840
     SSPTCLPHYP LHVLQGGGAE RYQGPPLPSL AQQMYYHRTG EPLHK                       885
//

If you have problems or comments...

PBIL Back to PBIL home page