(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE73

PENCW_10.PE73        Location/Qualifiers
FT   CDS             join(complement(182961..182994),complement(182691..182888),
FT                   complement(181507..182633),complement(181317..181367))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128944"
FT                   /orf_name="Pc13g00730"
FT                   /product="Pc13g00730 protein"
FT                   /protein_id="CAP91142.1"
FT                   /db_xref="UniParc:UPI0001830F6B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H153"
FT                   /transl_table=1
FT                   /translation="MGSRSLSSEFQECERKCQWLEQSRAPSTVHLPSDRWWGLITLHLN
FT                   LLHEHEQFFVMCQHPSVSLDVKNVPEKYEMSDRSLKYMLCFIETVSSILKRLILSNSEL
FT                   GDSLFEQLGDVARYGMFAEKLNREYWNVISRCWYQKAADRNPDSGRIQHHLGDLSQPDP
FT                   LQTLFFLTKALISAQPFPGSRVTVGRFFNDWPNLALQENSMATYFIAAHYVLLRGDSTG
FT                   RFMTFINGFLSLLPSYMEHHGHQGQHTVYVMSCNFASVFGYHNPAFMAVGSSQSQSGHT
FT                   PQTNELGPANQKQACVSNCSINQPAYPTKQALQGVHLTFRTLSVLLQYSNGHNSVPAIH
FT                   ISLAFLWGLTCHHPFMESLEARVPWRAITRFLNSLITPNDDFPKIEDASFPAADDGAAL
FT                   QLPEDFLIRGQTWSQLYYPKGFFNGSGDSISIEVDSEVKIRRYRCLWLGVQLAMTVIAT
FT                   TKHPEAEIKAN"
     MGSRSLSSEF QECERKCQWL EQSRAPSTVH LPSDRWWGLI TLHLNLLHEH EQFFVMCQHP        60
     SVSLDVKNVP EKYEMSDRSL KYMLCFIETV SSILKRLILS NSELGDSLFE QLGDVARYGM       120
     FAEKLNREYW NVISRCWYQK AADRNPDSGR IQHHLGDLSQ PDPLQTLFFL TKALISAQPF       180
     PGSRVTVGRF FNDWPNLALQ ENSMATYFIA AHYVLLRGDS TGRFMTFING FLSLLPSYME       240
     HHGHQGQHTV YVMSCNFASV FGYHNPAFMA VGSSQSQSGH TPQTNELGPA NQKQACVSNC       300
     SINQPAYPTK QALQGVHLTF RTLSVLLQYS NGHNSVPAIH ISLAFLWGLT CHHPFMESLE       360
     ARVPWRAITR FLNSLITPND DFPKIEDASF PAADDGAALQ LPEDFLIRGQ TWSQLYYPKG       420
     FFNGSGDSIS IEVDSEVKIR RYRCLWLGVQ LAMTVIATTK HPEAEIKAN                   469
//

If you have problems or comments...

PBIL Back to PBIL home page