(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE74

PENCW_10.PE74        Location/Qualifiers
FT   CDS             join(complement(184521..184918),complement(184001..184451))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948709"
FT                   /orf_name="Pc13g00740"
FT                   /product="Putative uncharacterized protein Pc13g00740 "
FT                   /protein_id="CAP91143.1"
FT                   /db_xref="UniParc:UPI0001830F6C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H155"
FT                   /transl_table=1
FT                   /translation="MSTRDLFSFEHMSYTSSPQYPSGSPVGMVDSFETGSENNVVDGGP
FT                   PPAPVALSTYSTPPLPPKYRTIKPRFSDGGLMPKPPDDTLGVKPRRHRSSGTRRNRQRQ
FT                   PQEKIGEPNPVQPEADSSMVSFTRPRSESFVPVTQYTDSDLFSRSQGPSLAPFLFSYSN
FT                   DLTSPAEIRSPLFPNIASAALAVDRPAYHHDVPSSLDSSDIQVSRPNPFFELSQDRDSM
FT                   RAASLQFSEHLEKTQVLQSLSILQDYMAKYPSVFEKQAPEMVQKWMLDIEGVKPPGSLS
FT                   E"
     MSTRDLFSFE HMSYTSSPQY PSGSPVGMVD SFETGSENNV VDGGPPPAPV ALSTYSTPPL        60
     PPKYRTIKPR FSDGGLMPKP PDDTLGVKPR RHRSSGTRRN RQRQPQEKIG EPNPVQPEAD       120
     SSMVSFTRPR SESFVPVTQY TDSDLFSRSQ GPSLAPFLFS YSNDLTSPAE IRSPLFPNIA       180
     SAALAVDRPA YHHDVPSSLD SSDIQVSRPN PFFELSQDRD SMRAASLQFS EHLEKTQVLQ       240
     SLSILQDYMA KYPSVFEKQA PEMVQKWMLD IEGVKPPGSL SE                          282
//

If you have problems or comments...

PBIL Back to PBIL home page