(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE75

PENCW_10.PE75        Location/Qualifiers
FT   CDS             join(185578..185720,185803..185849,185902..186137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948710"
FT                   /orf_name="Pc13g00750"
FT                   /product="Putative uncharacterized protein Pc13g00750 "
FT                   /protein_id="CAP91144.1"
FT                   /db_xref="UniParc:UPI0001830F6D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H156"
FT                   /transl_table=1
FT                   /translation="MTINGMIPSYLELFPKDSCCTFLLINIQGPFQVNPMPISTSRGIL
FT                   RASTKPHLLSGSDELRHLDIIGCREKRKAVDRKPQTTYTFKNCTFSGTSMFLVGSAGPT
FT                   SETVVYRDYGSRRPFLVNGDKGEATFLRDFCGRREYG"
     MTINGMIPSY LELFPKDSCC TFLLINIQGP FQVNPMPIST SRGILRASTK PHLLSGSDEL        60
     RHLDIIGCRE KRKAVDRKPQ TTYTFKNCTF SGTSMFLVGS AGPTSETVVY RDYGSRRPFL       120
     VNGDKGEATF LRDFCGRREY G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page