(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE76

PENCW_10.PE76        Location/Qualifiers
FT   CDS             join(complement(187390..187503),complement(187069..187259),
FT                   complement(186585..187008))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948711"
FT                   /orf_name="Pc13g00760"
FT                   /product="Putative uncharacterized protein Pc13g00760 "
FT                   /protein_id="CAP91145.1"
FT                   /db_xref="UniParc:UPI0001831035"
FT                   /db_xref="UniProtKB/TrEMBL:B6H157"
FT                   /transl_table=1
FT                   /translation="MXTGFPAWXHNLPTPLPLDQVPRHIRLVGVSLNIPSGQPASPQAE
FT                   AHVGFHSHGKAIISXNIDEYALINHTIGFHGQEAFRXMQKSYKRVAMPSQAVHQSLKTQ
FT                   KHNGPNSCVPLQFSSLPANDNTARGLLSTKSPLPSTHCKRIFPVESDFSLIDQFVARNN
FT                   PALENILSNLKRCDAALLESFYRSAFEGLDPDTCEAILHLWMRALSPKALVGIQNTYSR
FT                   ELTYPGLCFQEPITLTRTDH"
     MXTGFPAWXH NLPTPLPLDQ VPRHIRLVGV SLNIPSGQPA SPQAEAHVGF HSHGKAIISX        60
     NIDEYALINH TIGFHGQEAF RXMQKSYKRV AMPSQAVHQS LKTQKHNGPN SCVPLQFSSL       120
     PANDNTARGL LSTKSPLPST HCKRIFPVES DFSLIDQFVA RNNPALENIL SNLKRCDAAL       180
     LESFYRSAFE GLDPDTCEAI LHLWMRALSP KALVGIQNTY SRELTYPGLC FQEPITLTRT       240
     DH                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page