(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE77

PENCW_10.PE77        Location/Qualifiers
FT   CDS             join(188099..188101,188165..188704)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948712"
FT                   /orf_name="Pc13g00770"
FT                   /product="Pc13g00770 protein"
FT                   /protein_id="CAP91146.1"
FT                   /db_xref="UniParc:UPI0001831036"
FT                   /db_xref="UniProtKB/TrEMBL:B6H158"
FT                   /transl_table=1
FT                   /translation="MISEADLKISAQTSLKALQIWSLGTPDLANAXKWQHDLDPEIASL
FT                   VVACQHLRKNGYRKGRRRLAQNSILNRLVQAMVEDLTDDSLKIFALLTWHFNADFSVPL
FT                   PRQLLLFFDEPSKIFEDVCTDIHRRYTTMAKPGSVKSFKRRFIRLLGLVEHYVFEGKWS
FT                   CIFKSSDYVIIVAAICQ"
     MISEADLKIS AQTSLKALQI WSLGTPDLAN AXKWQHDLDP EIASLVVACQ HLRKNGYRKG        60
     RRRLAQNSIL NRLVQAMVED LTDDSLKIFA LLTWHFNADF SVPLPRQLLL FFDEPSKIFE       120
     DVCTDIHRRY TTMAKPGSVK SFKRRFIRLL GLVEHYVFEG KWSCIFKSSD YVIIVAAICQ       180
//

If you have problems or comments...

PBIL Back to PBIL home page