(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE78

PENCW_10.PE78        Location/Qualifiers
FT   CDS             join(190282..190458,190506..191009)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977827"
FT                   /orf_name="Pc13g00780"
FT                   /product="Putative uncharacterized protein Pc13g00780 "
FT                   /protein_id="CAP91147.1"
FT                   /db_xref="UniParc:UPI0001831037"
FT                   /db_xref="UniProtKB/TrEMBL:B6H159"
FT                   /transl_table=1
FT                   /translation="MSHPGNNLSLFVRNLDQGTREHLGHNTNTGPAHLTPEPCSSIPTE
FT                   SQAPAIMSLVEDFYFPFPRTSFRAAETTLIVQQAWFLGSKYLKRAIKRQHKLNDRTTFL
FT                   ISSCQALRKYRYLPWGKRRALAKNRRLRNYAHRMAGELADCDLAMLSLLAWHFSSKMVP
FT                   LPQGLLQFFANFDEQFDTVCRSIHLSYTKMCEPDTLANFKERLRGLLRLXERHVIIGDG
FT                   VLYT"
     MSHPGNNLSL FVRNLDQGTR EHLGHNTNTG PAHLTPEPCS SIPTESQAPA IMSLVEDFYF        60
     PFPRTSFRAA ETTLIVQQAW FLGSKYLKRA IKRQHKLNDR TTFLISSCQA LRKYRYLPWG       120
     KRRALAKNRR LRNYAHRMAG ELADCDLAML SLLAWHFSSK MVPLPQGLLQ FFANFDEQFD       180
     TVCRSIHLSY TKMCEPDTLA NFKERLRGLL RLXERHVIIG DGVLYT                      226
//

If you have problems or comments...

PBIL Back to PBIL home page