(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE79

PENCW_10.PE79        Location/Qualifiers
FT   CDS             join(complement(192437..192469),complement(192100..192387))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948713"
FT                   /orf_name="Pc13g00790"
FT                   /product="Putative uncharacterized protein Pc13g00790 "
FT                   /protein_id="CAP91148.1"
FT                   /db_xref="UniParc:UPI0001831038"
FT                   /db_xref="UniProtKB/TrEMBL:B6H160"
FT                   /transl_table=1
FT                   /translation="MISAEELDELAKQQSSSNFNVGNLRIRILGQLVDSRSTNVYHMQR
FT                   EIRKTEEIPGTKDIMQELWFEHYWASQTELIKSSIGRDLLQDDASKGVSEPLPEDHAFD
FT                   YS"
     MISAEELDEL AKQQSSSNFN VGNLRIRILG QLVDSRSTNV YHMQREIRKT EEIPGTKDIM        60
     QELWFEHYWA SQTELIKSSI GRDLLQDDAS KGVSEPLPED HAFDYS                      106
//

If you have problems or comments...

PBIL Back to PBIL home page