(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE80

PENCW_10.PE80        Location/Qualifiers
FT   CDS             join(complement(195666..195726),complement(195482..195616),
FT                   complement(194220..195308),complement(193886..194151))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948714"
FT                   /orf_name="Pc13g00800"
FT                   /product="Pc13g00800 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAP91149.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI0001831039"
FT                   /db_xref="UniProtKB/TrEMBL:B6H161"
FT                   /transl_table=1
FT                   /translation="MWARLPTLVPLGICSGCRPLDAAVSTSESEESSRTCWSDDGAQPE
FT                   AARAGTRRPLVTGDPAGDDEVWSQHRQQFQDINQAIRREPRFILRVHRVHRVHRVHRVH
FT                   RVHRVHRVHRVHSVHSVHRVHRVHRVHRVHRVHRVHRVHRVHRVHRVHSVHKLIAANMN
FT                   KFAPIYQKHKDIGAEQTIPEADISLFEERLVIVCTVDETQNHRRVRIPNRVKLIRSRER
FT                   KAQRLYLKILEKFPGIFLAFILSVSPRASIDFDLSAFCEQHIEQPIVLCDNAESLLWRS
FT                   AIRHGIEKSKAFGKLMSLLFTLPRPATEAEGEEICSLSLSRLSVIRIAFGDIICEAVEC
FT                   SPTHLPMNADSDYAEITQCVRTTVFYSHQDTIIHIEVGCAVKLADMLFPSASGRINSAL
FT                   SQSNASIQARNPEAALPPGTQSESLVQDYDFAYFTLRGASVAGIRSVFSASICEAIEES
FT                   ELRRWEKHHLLTEVTDCITMQLWRAESQRGLIKLRVGHYTGVNLANNLYAEPRSCIAS"
     MWARLPTLVP LGICSGCRPL DAAVSTSESE ESSRTCWSDD GAQPEAARAG TRRPLVTGDP        60
     AGDDEVWSQH RQQFQDINQA IRREPRFILR VHRVHRVHRV HRVHRVHRVH RVHRVHSVHS       120
     VHRVHRVHRV HRVHRVHRVH RVHRVHRVHR VHSVHKLIAA NMNKFAPIYQ KHKDIGAEQT       180
     IPEADISLFE ERLVIVCTVD ETQNHRRVRI PNRVKLIRSR ERKAQRLYLK ILEKFPGIFL       240
     AFILSVSPRA SIDFDLSAFC EQHIEQPIVL CDNAESLLWR SAIRHGIEKS KAFGKLMSLL       300
     FTLPRPATEA EGEEICSLSL SRLSVIRIAF GDIICEAVEC SPTHLPMNAD SDYAEITQCV       360
     RTTVFYSHQD TIIHIEVGCA VKLADMLFPS ASGRINSALS QSNASIQARN PEAALPPGTQ       420
     SESLVQDYDF AYFTLRGASV AGIRSVFSAS ICEAIEESEL RRWEKHHLLT EVTDCITMQL       480
     WRAESQRGLI KLRVGHYTGV NLANNLYAEP RSCIAS                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page