(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE83

PENCW_10.PE83        Location/Qualifiers
FT   CDS             join(201893..201901,201937..201953,202017..202326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948716"
FT                   /orf_name="Pc13g00830"
FT                   /product="Pc13g00830 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91152.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI000183103C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H163"
FT                   /transl_table=1
FT                   /translation="MVHFKEENRGTIVLLKIEVEGVRPNIAYSTMPRKYSWVKKRRSET
FT                   AKAASQQKNRRKNTIYKRAAEYSLECKADTLVAIQIRKTGEIYVFDSTGGRWLGTLSRL
FT                   VFCTEVW"
     MVHFKEENRG TIVLLKIEVE GVRPNIAYST MPRKYSWVKK RRSETAKAAS QQKNRRKNTI        60
     YKRAAEYSLE CKADTLVAIQ IRKTGEIYVF DSTGGRWLGT LSRLVFCTEV W                111
//

If you have problems or comments...

PBIL Back to PBIL home page