(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE84

PENCW_10.PE84        Location/Qualifiers
FT   CDS             join(203152..203246,203302..203626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076568" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824599"
FT                   /orf_name="Pc13g00840"
FT                   /product="Pc13g00840 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP91153.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI000183103D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H164"
FT                   /transl_table=1
FT                   /translation="MDDHITQRLSIIIKNNLHQSGAIAVRNTLVTRGAPYNRCRKPTLM
FT                   APEDVNKLVICHGEEGTASFCGSAVYGLGVEGSLDLYHGDARIASLHWNGPWARTGNQF
FT                   EATNVNSAKYLVNISGIPSHGILGDVSVIVTEVAC"
     MDDHITQRLS IIIKNNLHQS GAIAVRNTLV TRGAPYNRCR KPTLMAPEDV NKLVICHGEE        60
     GTASFCGSAV YGLGVEGSLD LYHGDARIAS LHWNGPWART GNQFEATNVN SAKYLVNISG       120
     IPSHGILGDV SVIVTEVAC                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page