(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE85

PENCW_10.PE85        Location/Qualifiers
FT   CDS             complement(204013..207624)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824600"
FT                   /orf_name="Pc13g00850"
FT                   /product="Pc13g00850 protein"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91154.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000183103E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H165"
FT                   /transl_table=1
FT                   /translation="MASTEQRLLSESRFSTILVNNLHCPSCVSTVNDTLFSLNPPPFSV
FT                   SVSIVLHEIKVAHPIDLSTSQIVHALEDAAFDIDSVVESGDSTNGGPESESLRTWRSTR
FT                   PSVVWRASDPDPHHESEQHIRQCDACSAQLATQSSRTGDDPPVIQKNLSPLVVESDSPR
FT                   DNDLVSVVDDHLTGTRTRITLSISGMSCSSCVGKITNALNDQPWVQSADVNLLTSSAVI
FT                   VLLDRSRVNEVLETITGSGYSAQLIDCEDLLPERQSKPSASTDIWRASYVIGGMTCSSC
FT                   VGTVTDTLNRYEWVTKVDVNLVSGSATVELQGKEHLEEVIAIISELGYAAALGEAERSA
FT                   PSEQRALNRSVTIQVEGMHCPNCPQRILDALSVFSNCLQVTDPLRKGRPRLTIAYTPDS
FT                   PNFTIRHILHAIAQADKAFTVSIYHPPSLEERSQMMQRRHMWRIARRLLLAVLTAIPAF
FT                   IIGIVYMSLVPGDNSGVMYLEQPIWAGRVSRMEWALFIMATPVYFFAADLFHRRMLSEL
FT                   VVLWWPGSKTPILRRFYRFGSMDMLMSLGTTVAYFSSIAILGINATQPADGLRVTHVES
FT                   FFDSVVFLTMFLMIGRLLEAYSKAKAGDAVSLLGKLRPTTAVLVASKEAEPSSPSVTPH
FT                   TVPIDQLELNDVVSVANGASPPYDGIVVEGTSRFDESSLTGESKPVPKSIGDEVFSGTT
FT                   NRANPVLVRITHLSGDSMLDQIISAVREGQVRRAPIERTADLITGYFVPLITLIAVLDW
FT                   IIWLSLGVSGRLPLSWLEGGAGGWEFWSLQFAISVFVVACPCGIGLAGPTALFVGGGLA
FT                   AQYGILVKGGGEAFQEASQLDCIVFDKTGTITEGVQPSVTDHKTTHEENIDEVWGAVLT
FT                   LEQKSSHPIAQAMVSFAGSRRPPALTASAVDEIPGKGMKGSFPLGHRPSSILDVIVGNE
FT                   ALMLDHGITILSANAAILTAWKREAKSVVLVGTRVREGAGDIEKVHWVLSMMLAVADPV
FT                   RPEAKEVLHALRNRGISVWMISGDNPTTAHAVGKIVGISPENIIAGILPEQKAEKIRYL
FT                   QKTVPRPSKRRWFNWGKGSRRTRPLVAMVGDGINDSPALTVADVGIAIGSGSEIAISSA
FT                   EFVLISSGLTSLLTLIDLSRIVFNRVKYNFGWALVYNCIAIPVAAGVFYPIVSNGNHIR
FT                   LDPVWASLAMALSSVSVVCSSLLMRTRLPLVGFRSAK"
     MASTEQRLLS ESRFSTILVN NLHCPSCVST VNDTLFSLNP PPFSVSVSIV LHEIKVAHPI        60
     DLSTSQIVHA LEDAAFDIDS VVESGDSTNG GPESESLRTW RSTRPSVVWR ASDPDPHHES       120
     EQHIRQCDAC SAQLATQSSR TGDDPPVIQK NLSPLVVESD SPRDNDLVSV VDDHLTGTRT       180
     RITLSISGMS CSSCVGKITN ALNDQPWVQS ADVNLLTSSA VIVLLDRSRV NEVLETITGS       240
     GYSAQLIDCE DLLPERQSKP SASTDIWRAS YVIGGMTCSS CVGTVTDTLN RYEWVTKVDV       300
     NLVSGSATVE LQGKEHLEEV IAIISELGYA AALGEAERSA PSEQRALNRS VTIQVEGMHC       360
     PNCPQRILDA LSVFSNCLQV TDPLRKGRPR LTIAYTPDSP NFTIRHILHA IAQADKAFTV       420
     SIYHPPSLEE RSQMMQRRHM WRIARRLLLA VLTAIPAFII GIVYMSLVPG DNSGVMYLEQ       480
     PIWAGRVSRM EWALFIMATP VYFFAADLFH RRMLSELVVL WWPGSKTPIL RRFYRFGSMD       540
     MLMSLGTTVA YFSSIAILGI NATQPADGLR VTHVESFFDS VVFLTMFLMI GRLLEAYSKA       600
     KAGDAVSLLG KLRPTTAVLV ASKEAEPSSP SVTPHTVPID QLELNDVVSV ANGASPPYDG       660
     IVVEGTSRFD ESSLTGESKP VPKSIGDEVF SGTTNRANPV LVRITHLSGD SMLDQIISAV       720
     REGQVRRAPI ERTADLITGY FVPLITLIAV LDWIIWLSLG VSGRLPLSWL EGGAGGWEFW       780
     SLQFAISVFV VACPCGIGLA GPTALFVGGG LAAQYGILVK GGGEAFQEAS QLDCIVFDKT       840
     GTITEGVQPS VTDHKTTHEE NIDEVWGAVL TLEQKSSHPI AQAMVSFAGS RRPPALTASA       900
     VDEIPGKGMK GSFPLGHRPS SILDVIVGNE ALMLDHGITI LSANAAILTA WKREAKSVVL       960
     VGTRVREGAG DIEKVHWVLS MMLAVADPVR PEAKEVLHAL RNRGISVWMI SGDNPTTAHA      1020
     VGKIVGISPE NIIAGILPEQ KAEKIRYLQK TVPRPSKRRW FNWGKGSRRT RPLVAMVGDG      1080
     INDSPALTVA DVGIAIGSGS EIAISSAEFV LISSGLTSLL TLIDLSRIVF NRVKYNFGWA      1140
     LVYNCIAIPV AAGVFYPIVS NGNHIRLDPV WASLAMALSS VSVVCSSLLM RTRLPLVGFR      1200
     SAK                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page