(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE87

PENCW_10.PE87        Location/Qualifiers
FT   CDS             join(<211811..211844,211897..211949,212006..212358,
FT                   212590..212884,212938..213081,213137..213481,
FT                   213538..213707,213768..213957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948718"
FT                   /orf_name="Pc13g00870"
FT                   /product="Pc13g00870 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91156.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831040"
FT                   /db_xref="UniProtKB/TrEMBL:B6H167"
FT                   /transl_table=1
FT                   /translation="ELPVGTTIHWHGILQRGTPDMDGVPGVTQYQIPPGGNFTYRFSVK
FT                   DEYGFYWYHSHFRAYYNDAIRGPLMVRPAPSRRRPFEDMAASTVEREQLLQAERDAVSI
FT                   LLNDWTHDLSDTIFSRYFETGAFPSCVDSILANGLGRVECLPSSDTMGESDTMGESMRL
FT                   GPRGCMPPMMFRPGYDINSLPAETCVNTTSQQLVVNANASQGWLALNLVNSGAVSNLKV
FT                   SLDSHSMHVYAADGLYVTPQEVKVLEIALGQRYSVMIELDQSPGNYYLRFATYPNGDMQ
FT                   QVLEGQAIVSYSTTGNDTQDILVDPMSVWMLTNGSATQDANELVESRLAPFEGNRPPTT
FT                   AADVTRFFNINQTDIVTWVVDQYPYAEPTIPIIYGNMSDGWNANTTLHSPTNSTVDIVM
FT                   NVANGSLDTMGHPMHLHGHKFWVLGSGSGSFPYQSVAEAPPSLINLDNPPYRDTANLPP
FT                   SGWLAIRYITDNPGAWILHCHIQWHIVVCQLPFFTLAIGGKTLTVGYTVWNGGGLSRGR
FT                   RSARCPNSAR"
     ELPVGTTIHW HGILQRGTPD MDGVPGVTQY QIPPGGNFTY RFSVKDEYGF YWYHSHFRAY        60
     YNDAIRGPLM VRPAPSRRRP FEDMAASTVE REQLLQAERD AVSILLNDWT HDLSDTIFSR       120
     YFETGAFPSC VDSILANGLG RVECLPSSDT MGESDTMGES MRLGPRGCMP PMMFRPGYDI       180
     NSLPAETCVN TTSQQLVVNA NASQGWLALN LVNSGAVSNL KVSLDSHSMH VYAADGLYVT       240
     PQEVKVLEIA LGQRYSVMIE LDQSPGNYYL RFATYPNGDM QQVLEGQAIV SYSTTGNDTQ       300
     DILVDPMSVW MLTNGSATQD ANELVESRLA PFEGNRPPTT AADVTRFFNI NQTDIVTWVV       360
     DQYPYAEPTI PIIYGNMSDG WNANTTLHSP TNSTVDIVMN VANGSLDTMG HPMHLHGHKF       420
     WVLGSGSGSF PYQSVAEAPP SLINLDNPPY RDTANLPPSG WLAIRYITDN PGAWILHCHI       480
     QWHIVVCQLP FFTLAIGGKT LTVGYTVWNG GGLSRGRRSA RCPNSAR                     527
//

If you have problems or comments...

PBIL Back to PBIL home page